Cherry SNP DataBase

Gene information

Gene Pav_sc0000551.1_g100.1.mk
Chromosome name PAV_r1.0chr1
start 168993
end 189815
PAV_r1.0 name Pav_sc0000551.1
start 168993
end 189815
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103324300
Sequence CDS GCACTGGGTGAGTCAAAACTGAAGAGACATGTCAGCTCCACATCAACGCCAAATCTGTTT GGTGACGGTAGCCGTAATTCTATTCCGCTCTTTGGAAACGAAGGGATGGATCATGATAAC CGTCTTCGTTTTCGTCTTCGTCTTCGTCGGGGATTGTTTCCTCTGCCTTTCTTCATTATT TCCATTTTTTTACTGTTCTTGGCAACTACATCAGCTGGATCTCCCTCTGGAAAAAGCAGC AGGTCATCAGTCTTCTCTTTATTTAACCTTAAAGAGAAGAGTAGGTTTTGGAGTGAGGCT GTTATACGTGGTGATTTTGATGATTTGGAATCTTCCAGCCCCGGAAAAATGGGTGTTCTC AACTACACAAATGCAGGCAATATTGCAAATTATCTCAAGCTTCTGGAAGTTGATTCTATG TACCTCCCAGTGCCTGTGAACTTCATTTTTATTGGATTTGATGGGAAAGGAAACCAAGAA TTCAAGCTTCACCCTGAAGAACTTGAGCGCTGGTTCACAAAAATTGATCATACCTTTGAA CATACACGCGTTCCTCAAATTGGAGAAGTCCTAACCCCGTTTTACAGGATTAGTGTAGAT AAAGAGCAACGACACCATCTTCCCATTGTCAGTCACATAAACTACAATTTTTCTGTTCAT GCAATACAAATGGGAGAAAAGGTTACTTCGATATTTGAGAAAGCCATAAATGTTTTCTCT CGCAAGGATGACTCATATGGTAACAGGGATGACGGGGATGCTCTGTGGCAAGTAGATGTG GACATGATGGATGTTCTTTTCACTAGCCTTGTTGGATATCTTGAACTTGAAAATGCGTAT AACGTTTTCATCTTGAATCCCAAGCACGACTCAAAAAGAGCTAAATATGGTTACCGGAGA GGTTTATCAGAATCAGAAATAAAATTTCTCAAAGAGAACAAGAATTTGCAAACCAAAATT CTTCAGTCGGGAAGCATTCCAGAAACTGTTCTTGCTCTTGATAAAATTAAGAGACCTTTG TACGAGAAGCATCCAATGGCAAAGTTTGCCTGGTCTGTAACTGAAGACACTGATACGGTG GAATGGTACAATGCATGCCAAGATGCTTTGAATAATGTGGAGAAGTTGTACCAAGGGAAG GAAACTGTGGATATCGTGCAGAACAAAGTTTTACAGTTACTGAAAGGGAAGAATGAAGAT ATGAAGCTTCTTTTCAGCCCTTTCTCATGGGGACCAGCTGTTGGTGGGGAAGGTGTTCGG ACAGAACTAAGTTCTCCCAATGTGCAAAAAACAATTGGTGCAGTTTCAGAAATTTCAGAA GATGAAGCAGAAGATCGCTTACAAGATGCTATTCAGGAAAAATTTGCCGTATTTGGTGAT AAAGATCATCAGGCCATTGATATTCTTCTTGCGGAGATTGATATATATGAGCTTTTTGCT TTCAAACATTGCAAAGGAAGGAAAGTAAAGCTGGCTCTTTGCGAAGAACTTGATGAGAGA ATGAGGGATTTGAAAAATGAGCTCCAATCATTTGAAGGTGAAGAATATGATGAAAGTCAT AAGAGAAAGGCTCTAGAGGCATTAAAGCGAATGGAGAATTGGAATTTGTTCAGTGATACT CAGGAGGAGTTTCAAAATTACACAGTTGCACGCGATACTTTTCTTTCTCATTTAGGTGCA AATTTGTGGGGGTCTATGAGACACATCATATCACCTTCCATAGCAGATGGTGCATTTCAT TATTATGATAAGATATCATTTCAGTTATTTTTCATCACGCAGGAGAAAGTTAGACATATT AAACAATTGCCTGTGGATCTCAAGGCTCTAATGGATGGACTCTCCTCTTTGTTGCTACCT TCTCAGAAACCTGCTTTCAGTCAGCACTTGTTACCACTTTCAGAGGATCCTGCTTTGGCA ATGGCCTTTTCAGTGGCACGAAGAGCAGCAGCTGTTCCTCTATTGCTTGTTAATGGAACT TACAGGAAATCTGTTCGATCCTATCTTGATTCCTCCATTGTTCAGTATCAGTTGCAGAGA ATGAATGATCATGGCTCTTTAAAAGGGAAGCATGCCCATAGCCGGTCTACACTAGAAGTT CCAATATTTTGGTTCATCCATGGTGAACCATTGTTGGTTGACAAGCATTATCAGGCAAAG GCACTTTCTGATATGGTTATTGTTGTTCAGTCAGAGCCTTCATCCTGGGAGAGCCATCTG CAATGTAACGGGCAGCCACTTTTGTGGGATTTGAGGAGGCCCATCAAAGCTGGGTTGGCT GCGGTTTCTGAACATCTTGCTGGTTTGCTTCCCCTCCACCTTGCTTACAGTCAAGCCCAT GAAACTGCAATTGAGGACTGGATGTGGTCAGTCGGATGCAACCCGTATTCCATTACTTCT CAAGGATGGAACATTTCCCAATTTCAATCTGATACAATTGCTCGGAGCTATATTATCACA ACTCTGGAAGAGTCAGTACAAATGGTCAATTCAGCCATTCATCTTCTAGTCATGGAGCGT ACAACTGAAAAAACCTTCAAACTTGTTCAGTCTCAGGAGCGTGAACTAATTAACAAGTAC AATTATGTTGTTAGTCTATGGAGAAGAATTTCAACTGTTACTGGAGAATTGCGGTATGTG GACGCCATGAGACTGCTATATACCCTAGAAGATGCGTCAAAAGGTTTTGTTGATCAAGTA AATACAACTATAGCCATTCTCCACCCAATCCACTGCACAAGAGAGAGAAAAGTACATGTG GTGTTTAATGTGACTACAATTCCTGCTTTCTTAGTTGTTCTGGGTGTACTCTATCTTGTG TTAAGGCCAAGACGACCAAAGCCAAAAATCAACTGA
PEP ALGESKLKRHVSSTSTPNLFGDGSRNSIPLFGNEGMDHDNRLRFRLRLRRGLFPLPFFII SIFLLFLATTSAGSPSGKSSRSSVFSLFNLKEKSRFWSEAVIRGDFDDLESSSPGKMGVL NYTNAGNIANYLKLLEVDSMYLPVPVNFIFIGFDGKGNQEFKLHPEELERWFTKIDHTFE HTRVPQIGEVLTPFYRISVDKEQRHHLPIVSHINYNFSVHAIQMGEKVTSIFEKAINVFS RKDDSYGNRDDGDALWQVDVDMMDVLFTSLVGYLELENAYNVFILNPKHDSKRAKYGYRR GLSESEIKFLKENKNLQTKILQSGSIPETVLALDKIKRPLYEKHPMAKFAWSVTEDTDTV EWYNACQDALNNVEKLYQGKETVDIVQNKVLQLLKGKNEDMKLLFSPFSWGPAVGGEGVR TELSSPNVQKTIGAVSEISEDEAEDRLQDAIQEKFAVFGDKDHQAIDILLAEIDIYELFA FKHCKGRKVKLALCEELDERMRDLKNELQSFEGEEYDESHKRKALEALKRMENWNLFSDT QEEFQNYTVARDTFLSHLGANLWGSMRHIISPSIADGAFHYYDKISFQLFFITQEKVRHI KQLPVDLKALMDGLSSLLLPSQKPAFSQHLLPLSEDPALAMAFSVARRAAAVPLLLVNGT YRKSVRSYLDSSIVQYQLQRMNDHGSLKGKHAHSRSTLEVPIFWFIHGEPLLVDKHYQAK ALSDMVIVVQSEPSSWESHLQCNGQPLLWDLRRPIKAGLAAVSEHLAGLLPLHLAYSQAH ETAIEDWMWSVGCNPYSITSQGWNISQFQSDTIARSYIITTLEESVQMVNSAIHLLVMER TTEKTFKLVQSQERELINKYNYVVSLWRRISTVTGELRYVDAMRLLYTLEDASKGFVDQV NTTIAILHPIHCTRERKVHVVFNVTTIPAFLVVLGVLYLVLRPRRPKPKIN


| Top |