Cherry SNP DataBase

Gene information

Gene Pav_sc0000554.1_g1010.1.mk
Chromosome name PAV_r1.0chr2
start 20078021
end 20082944
PAV_r1.0 name Pav_sc0000554.1
start 517437
end 522360
direction +
Annotation NR PREDICTED: dolichyl-phosphate beta-glucosyltransferase
Sequence CDS ATGGAGTTTGTAATTGTATGGACGATGGTGGAGCTCCTGTTCGCCCTCATTCTCATCGTA GCATTAGGTTTTGTTTCTGCAGTCTTCTTCGAAGCTTATCGAAGAAAAAACAACAACGCG CACGTTGAAGCTCCTGCGATCTTCGAGGACCCGAAATCGTTGAAACAGGTTCGTTGCCCT TCGATTTTTGATCCGGCTGAAAAGTATATATCTTTGATAGTCCCTGCATTCAATGAGGAG CTTAGGCTTCCTGGAGCCCTTGAGGAAACCATGAATTATCTTCAACAACGTGCCACAAAG GATAAATCATTTTCTTATGAGGTGGTGATTGTTGATGATGGAAGTGTTGATGAGACAAAA AGAGTAGCATTTGAATTTGTAAAGAAATACTCTGTGGATAATGTGAGGGTTATCCTTCTT GGTAAAAATCATGGAAAGGGAGAAGCTATCAGAAAAGGAATGCTTCATTCACGGGGTGAG CTACTTTTAATGCTGGATGCTGATGGAGCAACCAAGGTTAATGATGCAGAAAAACTTGAA AACCAGATCCATGCAGCTGCCAAAGAGGAATATAAGTTTGGGGACTCATCTGCTAGTAAT TCAAGTTTCCATCTTGTGGTTCTTTTGGCTGCTGGTCCCGGAATTCGTGATACACAATAT TCTTAA
PEP MEFVIVWTMVELLFALILIVALGFVSAVFFEAYRRKNNNAHVEAPAIFEDPKSLKQVRCP SIFDPAEKYISLIVPAFNEELRLPGALEETMNYLQQRATKDKSFSYEVVIVDDGSVDETK RVAFEFVKKYSVDNVRVILLGKNHGKGEAIRKGMLHSRGELLLMLDADGATKVNDAEKLE NQIHAAAKEEYKFGDSSASNSSFHLVVLLAAGPGIRDTQYS


| Top |