Cherry SNP DataBase

Gene information

Gene Pav_sc0000554.1_g2040.1.mk
Chromosome name PAV_r1.0chr2
start 19580162
end 19585834
PAV_r1.0 name Pav_sc0000554.1
start 1014547
end 1020219
direction +
Annotation NR PREDICTED: dirigent protein 25-like
Sequence CDS ATGACCTACCTACTCTTTCTCACACTCACCATTTTCTCTGCCACATCAGCACGAACTCTC GAGGAGGAGCAGCTACCAGTTCCTGTAGTCCCTCCATTGGCGTCCAATACAGACGAGACA CCTATCATCAATGCTAATGTTGCTGATCAACATACCTTAATGTTCTTCATGCACGACATC CTCGGAGGATCGAACCCCACGGCTCGAGCCATGACCGGGATAGTCAACAGCCCTGCAGCC AATGGCCAACTGCCATTTGCCAAACCCAATGGGGCAGTCCTACCTTACAACAACGGGGTA CCCCAGAACAACAACAACAACATCCCTTTTCTCACAGGGCTAAGTGGAACAACATCAAAT GTGGCACAAAACAACGGGATCAATGGCGGGTTCGGAAACTTCCCGATAAACAGTGGACAG CTCCAGCCAGGCTCCGTGCTCCAAAATCTCATGTTTGGCACCATGAGTGTGTTTGACGAT GAGCTGACTGAAGGGCATGAGCTTAGCTCTGGTTTGGTTGGGAAGGCACAAGGTTTCTAT GTGGTGAGCTCTGAAGATGGTACCAGCCAGACTATGGGGTTCACGGCTATGTTCGAAAGC GGGAGCTATGCCGATAGCCTGAGCTTCTTTGGGGTTCATCGGACGGCTGTATCAGAGTCT CATTTGGCCATCATGGGTGGCACTGGCAAGTATGTGAATGCCAAAGGTTTTGCCATAGTC AAGACCTTCCCTGCTTCCAATCAGCAAACTGATGGGGCAGAGACTCTGCTGCAATTCACA GTTTATCTCACTTACTAA
PEP MTYLLFLTLTIFSATSARTLEEEQLPVPVVPPLASNTDETPIINANVADQHTLMFFMHDI LGGSNPTARAMTGIVNSPAANGQLPFAKPNGAVLPYNNGVPQNNNNNIPFLTGLSGTTSN VAQNNGINGGFGNFPINSGQLQPGSVLQNLMFGTMSVFDDELTEGHELSSGLVGKAQGFY VVSSEDGTSQTMGFTAMFESGSYADSLSFFGVHRTAVSESHLAIMGGTGKYVNAKGFAIV KTFPASNQQTDGAETLLQFTVYLTY


| Top |