Cherry SNP DataBase

Gene information

Gene Pav_sc0000554.1_g2070.1.mk
Chromosome name PAV_r1.0chr2
start 19568902
end 19573954
PAV_r1.0 name Pav_sc0000554.1
start 1026427
end 1031479
direction +
Annotation NR PREDICTED: splicing factor 3B subunit 3-like
Sequence CDS ATGTACCTGTACAGCCTCACTCTTCAGCGAGCGACGGGCATAGTCTGTGCCATCAATGGC AATTTCTCCGGCGGAAAGGCCCAAGAGATTGTCGTCGCCAGAGGCAAAGTTCTCGACCTT ATTCGACCCGACGAAAATGGTAAGATCCAGACTCTACTCTCTGTTGAAATTTTCGGCGTC ATTAGGTCTTTAGCTCAGTTTAGGCTCACTGGTTCTCAGAAAGACTATATTGTTGTTGGG TCCGATTCTGGTCGAATAGTAATTCTTGAGTATAACAAGGAAAAGAATGTCTTTGATAAA GTCCACCAAGAAACTTTCGGTAAGTCGGGTTGTCGCAGGATAGTTCCGGGCCAGTATTTG GCCATTGACCCCAAGGGGAGGGCTGTTATGGTTGGGGCCTGTGAAAAGCAGAAGCTTGTT TACGTTTTGAATAGGGATACATCTGCAAGGTTAACTATATCATCCCCCTTGGAGGCCCAC AAGTCGCATACGATAGTGTATTCAATTTGTGGGGTTGATTGTGGGTTTGATAACCCCATA TTTGCTGCCATTGAGTTGGATTATTCGGAAGCCGATCAGGACTCTACTGGGCAGGCGGCA AACGAGGCACAGAAGCATTTGACTTTCTACGAGCTCGACCTTGGGCTTAACCATGTCTCT AGGAAGTGGTCGGATCAGGTTGATAATGGGGCAAATTTACTGGTCACAGTTCCTGGAGGT GGGGATGGGCCAAGTGGTGTATTGGTCTGTGCGGAAAATTTTGTGATTTACAAGAATCAG GATAAACCAGATCTTAGGGCCGTGATTCCTAGGCGTGCAGATTTGCCGGCTGAGCGTGGG GTTCTTATAGTTTCAGCAGCTATGCACAAGCAGAAGTCAATGTTCTTTTTCCTTTTGCAG ACAGAGTATGGGGATATATTTAAGGTTACTCTGGACCATGATAATGACAAGGTCTCAGAA CTGAAGATCAAATATTTTGATACAATTCCAGTTACAACTTCAATGTGTGTGTTAAAATCT GGGTTTTTGTTTGCTGCGTCAGAGTTTGGGAATCACTCTTTGTACCAGTTCCGAGCAATA GGCGAAGATCCTGATGTGGAGTCTTCCTCAGCTACATTGATGGAAACTGAAGAAGGTTTC CAACCTTTGTTTTTCCAGCCTAGAAGACTTAAGAACCTTGTTAGGATTGATCAGGTTGAG AGCTTAATGCCGATAATGGATATGAAGGTCAATAATCTCTTTGAGGAAGAAACACCTCAA ATATTTACACTTTGTGGGCGGGGCCCTCGTTCATCCCTCAGGATTCTAAGGCCCGGTTTA GCTATCAGTGAGATGGCTGTGTCAGAGCTTCCAGGTGTACCGAGTGCAGTCTGGACAGTG AAAAAGAATGTATCTGATGAGTTTGACGCATACATTGTGGTGTCATTTGCAAATGCTACC CTTGTGCTTTCAATTGGTGAGACAGTGGAAGAAGTTAGTGACAGTGGGTTTCTTGACACT ACCCCATCACTTGCAGTTTCTTTGATAGGTGATGATTCTCTCATGCAAGTTCACCCAAAT GGAATTAGGCATATTAGGGAAGATGGACGTATTAATGAATGGAGAACTCCTGGGAAGAGA ACGATCGTCAAGGTTGGCTCTAATAGACTTCAAGTGGTTATTGCTCTGAGCGGCGGAGAA CTTATATATTTTGAAGTTGATATGACGGGTCAATTGATGGAGGTGGAGAAGCATGAAATG TCTGGTGATGTAGCTTGTCTGGACATTGCCCCTGTACCTGAAGGGAGACAGAGATCTCGT TTCCTTGCAGTTGGTTCATATGACAACACTATTCGTATTTTGTCATTGGATCCTGATGAC TGTATGCAGATTCTGAGTGTGCAAAGTGTTTCTTCAATTCCAGAATCTCTCCTATTTCTT GAGGTTCAGGCATCAATTGGTGGGGAGGATGGTGCTGATCATCCTGCCAGCCTTTTCCTT AATGCTGGTTTACGTACTGGGATTCTGTTCAGGACAGTGGTAGATATGGTGACAGGTCAG CTTTCTGATTCCCGTTCTCGATTCTTAGGACTAAGAGCTCCGAAGCTATTTTCTATTAGT GTGAGAGGCAAGCATGCTATGCTTTGTTTGTCAAGTCGGCCCTGGCTCGGTTATATTCAT CAAGGACATTTTCTGTTAACACCCCTATCTTATGAGACACTTGAATATGCCGCCTCATTT TCATCTGATCAATGTGCGGAAGGTGTAGTTGCTGTTGCTGGAAATGCTTTGAGGGTTTTT ACTATTGAAAGGTTGGGAGAAACCTTTAACGAAACTGTGGTTCCACTGAGGTATACTCCT AGAAAGTTTGTTGTTCAACTCAAACGAAAGCTATTAGTAATTATTGAAAGTGATCAAGGA GCATTCACAGCAGAAGAGCGTGAAGCTGCAAAAAAGGAGTGCTTTGAGGCTGCGGGAATT GGTGAAAATGGAAATGGTAATGTTGATCAGATGGAAAATGGTGGTGATAATGAGGATGAT CCCCTCTCCGATGAGCACTATGGCTATCCTAAGGCAGAGTCTGACAAATGGGTTTCTTGC ATTAGAGTTCTTGACCCCAAGACAGCAACTACAACTTGTCTGCTGGAGCTTCAGGATAAC GAAGCTGCATTCAGTATATGCACAGTGAATTTCCACGATAAGGAGTATGGTACGCTTTTA GCTGTTGGTACAGCAAAGGGACTGCAGTTTTGGCCCAAAAGAAGTGTAACGGCAGGGTAT ATTCATATCTATAGATTTCTAGATGATGGAAAGTCCCTTGAACTTTTGCACAAGACACAA GTGGATGGTGTTCCTCTTGCTTTATGCCAGTTTCAGGGAAGATTACTAGCAGGCATAGGA CCAGTGCTCAGACTGTATGATTTGGGGAAAAAAAGATTGCTTAGAAAATGTGAGAATAAG CTGTTTCCCAACTCCATTATATCTATTCAAACCTATCGTGATAGGATTTACGTAGGTGAC ATTCAAGAGTCATTTCACTACTGCAAGTACAGACGGGATGAGAATCAGTTGTATATCTTT GCTGATGATTGTGTTCCAAGATGGCTTACAGCGTCATATCATATAGATTTTGACACCATG GCAGGTGCAGACAAGTTTGGAAATGTCTATTTTGTGCGGTTACCACAGGATGTTTCAGAT GAGATAGAAGAGGATCCAACAGGTGGGAGGATAAAATGGGAGCAGGGGAAGTTGAATGGC GCTCCCAACAAAGTAGAGGAGATAGTGCAGTTTCATGTTGGTGATGTGGTCAGCTGTGTG CAGAAGGCATCTCTAATTCCAGGTGGTGGGGAATGCATCATCTATGGGACAGTGATGGGT AGCTTGGGTGCATTGCTTGCATTCACCTCTCGTGATGATGTTGACTTCTTTTCTCACCTG GAGATGTATATGAGGCAGGAGCATCCGCCCTTGTGTGGTAGAGATCACATGGCTTATAGA TCAGCTTATTTTCCGGTTAAGGATGTGATTGATGGAGATCTGTGCGAGCAGTTCCCAACA TTGCCTATGGATCTGCAGAGAAAAATTGCGGATGAGTTAGATAGAACTCCTGGAGAGATA CTGAAGAAACTTGAGGAAATTCGAAATAAGATCATTTAA
PEP MYLYSLTLQRATGIVCAINGNFSGGKAQEIVVARGKVLDLIRPDENGKIQTLLSVEIFGV IRSLAQFRLTGSQKDYIVVGSDSGRIVILEYNKEKNVFDKVHQETFGKSGCRRIVPGQYL AIDPKGRAVMVGACEKQKLVYVLNRDTSARLTISSPLEAHKSHTIVYSICGVDCGFDNPI FAAIELDYSEADQDSTGQAANEAQKHLTFYELDLGLNHVSRKWSDQVDNGANLLVTVPGG GDGPSGVLVCAENFVIYKNQDKPDLRAVIPRRADLPAERGVLIVSAAMHKQKSMFFFLLQ TEYGDIFKVTLDHDNDKVSELKIKYFDTIPVTTSMCVLKSGFLFAASEFGNHSLYQFRAI GEDPDVESSSATLMETEEGFQPLFFQPRRLKNLVRIDQVESLMPIMDMKVNNLFEEETPQ IFTLCGRGPRSSLRILRPGLAISEMAVSELPGVPSAVWTVKKNVSDEFDAYIVVSFANAT LVLSIGETVEEVSDSGFLDTTPSLAVSLIGDDSLMQVHPNGIRHIREDGRINEWRTPGKR TIVKVGSNRLQVVIALSGGELIYFEVDMTGQLMEVEKHEMSGDVACLDIAPVPEGRQRSR FLAVGSYDNTIRILSLDPDDCMQILSVQSVSSIPESLLFLEVQASIGGEDGADHPASLFL NAGLRTGILFRTVVDMVTGQLSDSRSRFLGLRAPKLFSISVRGKHAMLCLSSRPWLGYIH QGHFLLTPLSYETLEYAASFSSDQCAEGVVAVAGNALRVFTIERLGETFNETVVPLRYTP RKFVVQLKRKLLVIIESDQGAFTAEEREAAKKECFEAAGIGENGNGNVDQMENGGDNEDD PLSDEHYGYPKAESDKWVSCIRVLDPKTATTTCLLELQDNEAAFSICTVNFHDKEYGTLL AVGTAKGLQFWPKRSVTAGYIHIYRFLDDGKSLELLHKTQVDGVPLALCQFQGRLLAGIG PVLRLYDLGKKRLLRKCENKLFPNSIISIQTYRDRIYVGDIQESFHYCKYRRDENQLYIF ADDCVPRWLTASYHIDFDTMAGADKFGNVYFVRLPQDVSDEIEEDPTGGRIKWEQGKLNG APNKVEEIVQFHVGDVVSCVQKASLIPGGGECIIYGTVMGSLGALLAFTSRDDVDFFSHL EMYMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLPMDLQRKIADELDRTPGEI LKKLEEIRNKII


| Top |