Cherry SNP DataBase

Gene information

Gene Pav_sc0000555.1_g080.1.mk
Chromosome name PAV_r1.0chr1
start 17894892
end 17914714
PAV_r1.0 name Pav_sc0000555.1
start 51256
end 71078
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103322110 isoform X1
Sequence CDS ATGGAGGCGCAGCAGACCAAATCAGTTGCAGTAACTATACTTCACAATGCCACCATCGTC ACCATGGACCCCGACGCCCGAGTCTTCCGCAACGGTGGGGTCGTCATCGAGCGAGACGCA ATCGTAGCCGTCGGTCAATCTTCCGATATTCTTCACCAGTTCTCTTCTCTCGCCCATCAG GTTTTCGATCTCAACGGCCAAATCGTCCTCCCTGGATTGATCAACACGCACGTGCACACA TCTCAGCAGCTGGGAAGAGGGATAGCCGATGATGTGGATTTGATGACTTGGTTGCACCAT CGGATTTGGCCGTACGAGTCCAATATGAGCGAGGAAGATTCATACATTTCCACTCTGCTT TGTGGCATTGAGCTCATTCACTCTGGTGTTACTTGCTTTGCTGAAGCAGGAGGGCAACAT GCGTCAGGAATGGCAAGGGCAGTGGAGTTACTGGGCTTAAGGGCATGTTTGGCTGAATCC ATCATGGACGCTGGTGACGGCTTGCCCGCTTCTTGGGCCGGTCGGAGCACCGATGCTTGT ATCCAGCTGAAATTCATGTCCTCACTCACTCACTCACTGTTCAAACACTTTACAAGAAGA GCTCACTCACTCACTGAAATTGATGTCCTCACTCACTCGGCACAGTCTCAAAAAGAGCTT TACAAGAAGCACCATAATACGGGAGATGGGCGCATCAGAATGTGGTTAGGAATTAGGCAA ATTATGAATGCAACTGATGGATTACTACTTGCAACAAGAGATACTGCCAAAGAACTGAAA ACTGGCATTCACATGCATGTTGCAGAGATAGCATATGAGAATCAATTTGTGACAGAGACA AGAAAAGTTGACCATGGAACAGTCACGCACTTGGAGAAGATACAGTTTCTTCAGGACAAT TTGCTAGCGGCTCATACAGTTTGGGTTAATCCTGCTGAGATTGATTGTCTTTCAAGGGGT GGGGTCAAAATATCTCACTGCCCCGCTGCTGCAATGCGAATGCTTGGATTTGCACCTATT AGAGAGATGCTTGATGCTGGCATCTGTGTCTCTTTGGGAACAGACGGGGCGCCCTCAAAT AATAGAATGAGCATAGGATCCCTTGAGGTTGGGAAAAAGGCTGACTTGGTTGTTATCAAT CCCTCCTCTTGGACCATGGTTCCTCTCCATGACAGCATTTCCAGCCTCGTGTACAGTATG CGAACTGAAAATGTAGTGTCTGTAATGTGCAATGGTGAGTGGATTATGAAGGACAAGAAG ATTCTGAATGTGGATGAGGAAACGCGCGGCCCAAGTTCGCTTGGAAACTCCACTGATAGC AACCAGAAGGAAGGTTGGCGTTTGGAAGGATCTGATGACAAAAAAGATTGGAGGCGGCCT GCCACTGAAAGTGAAAATAGCCGTCGTTGGCGTGAAGAGGAAAGAGAAACTAGCTTGCTT GGTGGTAGAAGAGATCGCAGGAAACCAGAACGCCGTGTTGACAGTGTTCCAGTTAGAGAC ACAACTGACAATAGGACATTGCCTGCATCTGAAAGGTGGCATGATGGCCGTAATTCTGTG CATGAAGTGCGGCGTGATAGCAAATGGTCATCGAGGTGGGGTCCTGAAGACAAAGAAAAG GAGCCTCGAACTGAGAAGAGAACAGATGTAGAGAAGGAAGATGCTAACACTAACAATGAC AATCAATCCCTTGGAGGTAACAATCGTTCAGCTCTTGAGCGTGAGTCAGATTCTCGGGAC AAATGGAGGCCACGCCATAGAATGGAAGTTCACTCTGGTGGGTCAAGTACTTACCGTGCT GCACCTGGATTTGGAGAAAGAGGACGGGCGGAGGGTTCAAATTTGGGATTTACCCTTGGA AGAGGGAGGTCAAATGCCATTGGGAGATCATCTGCAGGCGTTATTGGCTCTGCTCCTTCT GGAAAAAGTGAAAGTGTCCCAGGGAAACCTAGGCACTCAGCTGATAGTTTTTGCTACCCT AGGGCAAAGCTTCTTGACATTTATCGTCAGAGAAGGCTTGATCTATCTTTTGCTACCATG CCAGATGAGATGGAGGAATCACTCCCTACAACTGAAGTACGATTTGTTGAACCACTGGCT TTTTTTGCCCCAGATGCTGAAGAAGAGGCCATCCTTAGTGATATATGGAAGGGAAAGATT ACAAGTAGCGGGGTAGTATACAATTCTTTTAGAAAGGGGCGATCAACTGAGAGCAGTACA GGTGTTGGAGACTTGGAAGCTGTCGATGGAGTTCTGGGTATTTTGCCCTCAAACATCCCT GAAGAGTCTATTAATACCTTGCAGGAGGCTGCAAGTGCTGATGCTAATGGGAGTTTGTGG AATTATGGTCCACAGAGGAATGTGGTAGATGAAAAAGATGTCAATCATAAAGAATGGCAA AACAAAGCTACTGCAGGAAAGGACCTTGATGGATTGTCCCTAACATTTCAAAAAAGTAAT GGTATCTGCAGTGATTTTGAGACTGATGGTGCTTACAATAGTACAGATCAGCTCCATGTC CGTGGCAGTAGGCAAATTGCAGATTCTACCTTTTCCAGTCATTCTCTCTCTGATGACATT GAGTTTATCCCTTCTTCTGACATAAGATCCAAACTTCCTGATGATTCAAATACTCTTTAT GCTTTAGGCTCTTCTGAGCAGATGCAGAGTACCAACCCTCGGGCAAAAGAATTAGAAAGG GATGTCCCTCCCGAGGACTTATGTTTGTATTACCTTGATCCTCAAGGGGTTATTCAGGGA CCATACCTGGGGGTAGACATTATTTCATGGTTTGAACAAGGTTTTTTCGGGACAGACTTG CTTGTTCGGTTGGCAGATACTCCTGAAGGAACACCTTTCAACGAATTGGGGGAGTTCATG CCACATCTGAAAGTTTGGGACGGGCAAGGGAATATCATGAATCCAAGTTCTAATAAAGAA GAATCCAGTGGCTTGATAGGGAACTTAGAGTCCAGTTTACCGTCTTCTGCTCTGGTTTCA GAAATTACTGATTCATTTATGGGGAATGACCTTCGGCGGCCATTGCCTGAACTAAACAAC CTTTCAGCTCAGCATATTCTACCCAGAACATCTGAGCCTGAAGCTCCATTACAACTGCCA AATTCCAGGGGTCAAAGCTTTAATGATTTTGTTGCAGATGATGAAGATATTGTGTTTCCA GGAATACCTGGAACCACCGGCTATTCTGCTGCAAAATCTTCAGGGACCATTCATGATCCC ATAGCTAATTCTATTAGCCACCTTCCTCCAACCGAGCTGACTGAATCTGGTATGCCTATT CAGAATGATAATAAGTTGCACCCCTTTGGCTTGCTATGGTCTGAACTAGAAGGCGGTCAA ACAAAACATATCAAGTCAGCCAATACGCCTTCTAGTGTGGGGAGGGCGGTTCCATTTGGT GCAATTTCTGATCCAGCAGTTGTTGCTGAGACGTGGCCTGATGTTCACAGAAAAAATACA GTCTCTGATACAAACCTGTATCAAGACATGATATCTCCTCGGCAATTGGCACACATGGAA CAGGAACCCAGTCATTATGATTTAGCGGAGCAGCTCATGACACAGCAAATTCAACAGCAG CAGCTCCAGCAGCGTAATATGTTGTCTAGTTTTGGGCACTTGAATGATGCAGTATTAGAG CATTTGCCAAATCAGAATCTTATTCACCAACAGTTAGCCAACCATTCTTCTGCCGACGTG GATCATCTTTTGGCACTTCAGATGCAACAGCATCGACAGGCTCAGCTCCAGCAACATCAT CAATTGCAGCAGCAGCAATTTCATCAACAGCAGAAGCTTTTACAGGAGCAACAGCAATCT CAAGTACAACAGGTGCTTCTTGAACAACTGCTGCGTGGTCAAATGCATGATCCTGCACTT AGGCAGCAACATGTTGATCCTGTCAGAGCAAACAATGTTCTTGATCAGGTTCTATTGGAG CAGCACCTTCTGCATGAGCTTCAACAACGGTCTCACCATCTTCCAAGGCATGTTGATCCA TCTATGGAACAGCTTATCCAAAAGTTTGGTCACACACCTCAAGGACATCAAACAGATTTG TTTGAGCTACTGTCTCGTGCGCAGCATGGGCAAATTCAATCGTTGGAACATCAGATGCAA GCCAGGCAGCAGTTACCAATGGGAATGAGGCAGAGGATGGAAGAAGAGAGGCATGTCAGT TCTGTCTGGCCAGCAGATGAATCAAATCAGTTTTTGAGGGGCCATGCTGGTACTCAGCAG CGAGCTCACTCTTCTGGATTTAGTCCTTTGGATTTTTACCAGAGGCAACAGAGGCCATCC CATGAGGAGCAGCTGAGTCACCTTGACCGGAATCATTCATTGCAGGATCGACTTCAGCAA GGGTTTTATGAGTCTGGCTCATTGCCGTTTGAGCGGTCAATGTCATTGCCTGCTGGTGCA CCAGGGATGAACTTGGATGTTGTAAATGCTATGGCTCGTGCTCAGGGTTTGGATATGCAG GATTCCGCTGGACGTATGCAATCAGCTGGTCAATTGGGAACATTTTCGTCTGGCATCCAT TCTCATAATCCTCATCACCCTCTTCCTAACCAATTTCATGTCTCACATTTGGATGCACTT GAGGGACACTGGTCTGAGAAGAATGAGCAGCTAGAAAATGACTGGCTGGACTCTCGGTTT CAACAGTTGCATATTAATGCTGAGCGGCAGAAAAGGGAGTCAGAAATCAAAATTCCTTCT CAGGATCGAACTTTATGGATGTCAGATGGATCTAATGAAGAGCATTCAAAGAGACTATTG ATGGAGTTACTCCATAAAAAATCAGGCCATCAACCTACTGAGTCATTGAATGTCAGCAAT GATATGTTCTCTGATAAAAGGCTGTCATCTGGCCTCTACTCTGGATCAAGCTCTTCAAAT CACCCATTCATTCTTCACACAGACCAAGAAGCAGGTCTAAATAATTCATTTCGAGTAGGA TCCTATGGTTCTAATCCATGTGAGCTCCCACAGGAAGAGCGAGCCTGCAGTGTGGAAAGC AATGAAAAATTGATGTATATACCTGATTCTGGAGCATTGATTGAGAGAGAGTCATTCTTG GCAGGCATCAATGCTACGACTCAGTCAATTTACACAAATTCTAACATGATTAGTAAGTCT TCTATCAATAAAGAACGTTCAGAGTTGGAGGGAAGGAAGCGTGGTTCCAAGAGTGAGGCG ATCATTATGGGTCGAGCTTTTGAGACTCAAGAACGAATGGCTGAACAAGCAGGTTTGGCT GCCCAAGATTATGGGGAGAGGGCAACAAATGCCCTTGGCATGCATAATTCATCTGGTGTT TCAGGTGGGAATGCAGGCTTTTACGGTGACAAGATTGGCCGAAGTAATTCATTTGCAGAA GAAACTACCAAGGATCGGCTGCCGGTCCCATCCAAAGGTCAAGACAATATTCTGCTGAGA CGACCTCCTGTCACAAATGCTTCAGCATCCCAAGAAGGATTGTCAGAACTGATTTCCAAT CCAGTTTTCAGAGGGAAAAATTCAAGTGGTGCTTCAGATGGGGGGAGGCCAGACCAAGTC ATTAATCCAGTAAACCAAGGTTCTGATGTCATTTCATCTACAAAGAAAGAAGTGCATTTT CGCCGTGCTTTATCCGTCAGTGATGCTGATGTGTCAGAGGCGTCATTTATGGATATGCTT AAGAGTAATACCAAGAAGGTTTGCATATGCCTTATTCGTCACAATTACACTTCTACAACT ACTAATATTTGTGGTGAAAAGACCAGATTCATACAGCACAGCAACGCTAAATGTTTTATA CTGAGGGCAAAATTGGTAGTGAAACAGAAAAGGACAAAAGAAAAGAGACTGGGGGCACGG CTTCATATTTTGCTGCAATTTGAACTTAAGAAAGTGAATACGCTCCAGAAAGGGGCAGGC
PEP MEAQQTKSVAVTILHNATIVTMDPDARVFRNGGVVIERDAIVAVGQSSDILHQFSSLAHQ VFDLNGQIVLPGLINTHVHTSQQLGRGIADDVDLMTWLHHRIWPYESNMSEEDSYISTLL CGIELIHSGVTCFAEAGGQHASGMARAVELLGLRACLAESIMDAGDGLPASWAGRSTDAC IQLKFMSSLTHSLFKHFTRRAHSLTEIDVLTHSAQSQKELYKKHHNTGDGRIRMWLGIRQ IMNATDGLLLATRDTAKELKTGIHMHVAEIAYENQFVTETRKVDHGTVTHLEKIQFLQDN LLAAHTVWVNPAEIDCLSRGGVKISHCPAAAMRMLGFAPIREMLDAGICVSLGTDGAPSN NRMSIGSLEVGKKADLVVINPSSWTMVPLHDSISSLVYSMRTENVVSVMCNGEWIMKDKK ILNVDEETRGPSSLGNSTDSNQKEGWRLEGSDDKKDWRRPATESENSRRWREEERETSLL GGRRDRRKPERRVDSVPVRDTTDNRTLPASERWHDGRNSVHEVRRDSKWSSRWGPEDKEK EPRTEKRTDVEKEDANTNNDNQSLGGNNRSALERESDSRDKWRPRHRMEVHSGGSSTYRA APGFGERGRAEGSNLGFTLGRGRSNAIGRSSAGVIGSAPSGKSESVPGKPRHSADSFCYP RAKLLDIYRQRRLDLSFATMPDEMEESLPTTEVRFVEPLAFFAPDAEEEAILSDIWKGKI TSSGVVYNSFRKGRSTESSTGVGDLEAVDGVLGILPSNIPEESINTLQEAASADANGSLW NYGPQRNVVDEKDVNHKEWQNKATAGKDLDGLSLTFQKSNGICSDFETDGAYNSTDQLHV RGSRQIADSTFSSHSLSDDIEFIPSSDIRSKLPDDSNTLYALGSSEQMQSTNPRAKELER DVPPEDLCLYYLDPQGVIQGPYLGVDIISWFEQGFFGTDLLVRLADTPEGTPFNELGEFM PHLKVWDGQGNIMNPSSNKEESSGLIGNLESSLPSSALVSEITDSFMGNDLRRPLPELNN LSAQHILPRTSEPEAPLQLPNSRGQSFNDFVADDEDIVFPGIPGTTGYSAAKSSGTIHDP IANSISHLPPTELTESGMPIQNDNKLHPFGLLWSELEGGQTKHIKSANTPSSVGRAVPFG AISDPAVVAETWPDVHRKNTVSDTNLYQDMISPRQLAHMEQEPSHYDLAEQLMTQQIQQQ QLQQRNMLSSFGHLNDAVLEHLPNQNLIHQQLANHSSADVDHLLALQMQQHRQAQLQQHH QLQQQQFHQQQKLLQEQQQSQVQQVLLEQLLRGQMHDPALRQQHVDPVRANNVLDQVLLE QHLLHELQQRSHHLPRHVDPSMEQLIQKFGHTPQGHQTDLFELLSRAQHGQIQSLEHQMQ ARQQLPMGMRQRMEEERHVSSVWPADESNQFLRGHAGTQQRAHSSGFSPLDFYQRQQRPS HEEQLSHLDRNHSLQDRLQQGFYESGSLPFERSMSLPAGAPGMNLDVVNAMARAQGLDMQ DSAGRMQSAGQLGTFSSGIHSHNPHHPLPNQFHVSHLDALEGHWSEKNEQLENDWLDSRF QQLHINAERQKRESEIKIPSQDRTLWMSDGSNEEHSKRLLMELLHKKSGHQPTESLNVSN DMFSDKRLSSGLYSGSSSSNHPFILHTDQEAGLNNSFRVGSYGSNPCELPQEERACSVES NEKLMYIPDSGALIERESFLAGINATTQSIYTNSNMISKSSINKERSELEGRKRGSKSEA IIMGRAFETQERMAEQAGLAAQDYGERATNALGMHNSSGVSGGNAGFYGDKIGRSNSFAE ETTKDRLPVPSKGQDNILLRRPPVTNASASQEGLSELISNPVFRGKNSSGASDGGRPDQV INPVNQGSDVISSTKKEVHFRRALSVSDADVSEASFMDMLKSNTKKVCICLIRHNYTSTT TNICGEKTRFIQHSNAKCFILRAKLVVKQKRTKEKRLGARLHILLQFELKKVNTLQKGAG


| Top |