Cherry SNP DataBase

Gene information

Gene Pav_sc0000567.1_g1160.1.mk
Chromosome name PAV_r1.0chr1
start 24486065
end 24491057
PAV_r1.0 name Pav_sc0000567.1
start 644087
end 649079
direction +
Annotation NR PREDICTED: alpha-xylosidase 1
Sequence CDS ATGTGCTCCCTATGTCTTTCTTCACTTCTCCTAGTCTTGTTGGTCCTCTGTTTCTCTGGT GTGAGCTCAGCTGACACCGTTAACCCCACCATTAAAGGCAAAGGCTACCGTTTGGTCTCC GTTCAAGAGACCTCTGATGGTGGCCTTCTGGGTCATCTCCAACTCATACAGAACTCCAAG GTCTACGGTCCTGATATCCCCCTCTTGCAGCTCTATGTCAAGCACGAGACGCAGGACCGT TTGAGGGTCCACATAACCGATGCTCAGAAGCAGAGATGGGAGGTTCCGTACAATCTTTTA CCCAGAGAGCAGCCTCCGTCACTGACACAAACCATTGGGAAAACAGGGAAGAACCCAATA ACAGTCTCCGAGTACTCTGGCTCTGAGCTGATCTTCACCTACATCTCAGACCCATTTGGG TTTGCAGTGAAGAGAAAGTCAGATGGGCAAGTTCTTTTCAACTCGAGCTCTGATCCTAAA GACCCATATGGTGAATTGGTGTTTAAGGACCAGTACCTCGAGATTTCCACTAGTCTACCC AAAGATGCCTCATTGTATGGCTTGGGAGAGAACTCACAGCCACATGGGATCAAACTCTAC CCAAATGATCCATATACTCTGTTCACCACTGATGTCTCAGCCATTAATCTTAACACTGAT TTATATGGCTCCCACCCTGTTTATATGGATCTGAGAAATGTGGGTGGTCAGGCTTATGCA CACTCTGTTTTGTTGCTCAACAGCAATGGCATGGATGTGTTTTACAGAGGAACTTCTTTG ACATACAAGGTCATTGGGGGTGTCTTTGATTTTTACTTCTTTGCCGGGCCTACTCCATTG GGTGTTGTTGATCAGTACACGTCATTCGTAGGCAGACCAGCCCCAATGCCTTACTGGTCT CTGGGTTTAGCTAATGATGTTTTCATCAAATATGAGGGTGAACCCTTCTTGGCGCAAGTT TGGCCAGGGGCTGTAAACTTTCCCGACTTCCTCAACCCGAAAACTGTATCCTGGTGGGGT GATGAGATCCGCCGCTTTCATGAACTTGTCCCTGTTGATGGCTTATGGATTGACATGAAC GAGGCTTCAAATTTCTGTTCTGGGAAGTGCAAAATTCCAAAGGGGCAGTGCCCGACTGGT TCTGGACCTGGCTGGGTATGTTGCTTGGATTGCAAAAACATTACAAAGACGAGATGGGAT GAACCACCTTACAAGATAAATGCTTCAGGATTGCAGGGAAAATCTGAGGTTAAGGCGTTG TTTCCCCCTGGAACCTGGTACAGTTTATTTGATCTGACACAGGTCATTAACTCGAAACAG GGCAAGTATGTTACACTTGATGCGCCTTTGCATGTAGTTAATGTGCATGTGTATCAGAAT TCCATTCTACCAATGCAGCAGGGTGGACTGATATCTAAAGCTGCAAGAACAACCCCTTTT AACCTCGTGGTAACCTTCCCAGCAGGGGCAAGCAATGCAACAGCTAAGGGGAACCTGTTC CTTGATGACGATGAGCTTCCAGAAATGAACCTTGGAAGTGGTTACTCCACATATGTTGAT TTCTATGCAACTGTAAGTCAAGGAAGTGTGAAAGTATGGTCAGAAGTTCAGGAGGGTAAG TTTGCTTTAGACAAAGGCTGGGTTGTGGAGAAGGTGAGTGTGTTGGGATTGGATGGAGGT GGAGGAACATCTGCTCTTGAGGTTGATGGAAACCCAGTGACAAGTGTTTCAAGCATAGAG TTGAGTACATCGGAACAGAAGTACCTTGAGGAGGCGGAAGATGGAGAGAAGACCAAGAGT GTGATGGTGGACGTTAATGGTTTGTCCCTTCCTGTGGGGAAAAACTTTGCTGTGTCATGG AAAATGGGGATCAAAGCTTGA
PEP MCSLCLSSLLLVLLVLCFSGVSSADTVNPTIKGKGYRLVSVQETSDGGLLGHLQLIQNSK VYGPDIPLLQLYVKHETQDRLRVHITDAQKQRWEVPYNLLPREQPPSLTQTIGKTGKNPI TVSEYSGSELIFTYISDPFGFAVKRKSDGQVLFNSSSDPKDPYGELVFKDQYLEISTSLP KDASLYGLGENSQPHGIKLYPNDPYTLFTTDVSAINLNTDLYGSHPVYMDLRNVGGQAYA HSVLLLNSNGMDVFYRGTSLTYKVIGGVFDFYFFAGPTPLGVVDQYTSFVGRPAPMPYWS LGLANDVFIKYEGEPFLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMN EASNFCSGKCKIPKGQCPTGSGPGWVCCLDCKNITKTRWDEPPYKINASGLQGKSEVKAL FPPGTWYSLFDLTQVINSKQGKYVTLDAPLHVVNVHVYQNSILPMQQGGLISKAARTTPF NLVVTFPAGASNATAKGNLFLDDDELPEMNLGSGYSTYVDFYATVSQGSVKVWSEVQEGK FALDKGWVVEKVSVLGLDGGGGTSALEVDGNPVTSVSSIELSTSEQKYLEEAEDGEKTKS VMVDVNGLSLPVGKNFAVSWKMGIKA


| Top |