Cherry SNP DataBase

Gene information

Gene Pav_sc0000581.1_g010.1.mk
Chromosome name PAV_r1.0chr6
start 16242765
end 16249120
PAV_r1.0 name Pav_sc0000581.1
start 2368
end 8723
direction +
Annotation NR PREDICTED: histidine--tRNA ligase, cytoplasmic-like isoform X2
Sequence CDS ATGCTTTCCTCCGCAGTCTCTTCATCCCTCCTTATCTTACACAAGCCCTTAGCTCGCGTT ATCAGATTCCCCATCCCCAAGCTCCCTCTCTCTCCAAACCCTAGACCCCTCTCTTCTCTC TCACCCGCCGCTTCTGCTCTCACCCCCAATGCCGTCGGCTCCGGCGGTCGCTCCGGAGCT CTATCTCCGGCGCCGATCACCGAAGACCTCCAGAAGATCGACGTCAACCCTCCCAAGGGC ACCAGGGACTTCCCGCCCGAAGATATGCGGCTCCGCAACTGGCTCTTCTACCATTTCAGA GAGGTCTCGCGGTTGTTTGGCTTCGAAGAGGTCGACTTTCCAGTTCTCGAGTCCGAGGCT CTGTATATTAGAAAAGCAGGAGAGGAAATTCGAGACCAGCTATATTGCTTCGAAGACCGA GGTAATCGTCGAGTTGCATTGAGGCCTGAGCTCACTCCTTCTTTGGCAAGACTGGTGATA CAGAAAGGAACAGAGAAAAGTAAACTAAAGTTCAAACTTGAAAGTGAGATACTTGGAGAT GCCTGTGAAGCAGTTGCTGATCTGAAACAGCTATTCTCTCTTGCTGAGAAATTTGGTTAT TCTGAATGGATTCAGTTTGATGCTTCTATTGTTCGTGGCCTTGCCTACTATACTGGTATT GTCTTCGAGGGTTTTGATAGAGGAGGAAAGTTGCGAGCCATTTGTGGTGGTGGGCGATAT GATCGCTTGCTTTCTACTTTTGGTGGTGATGACATTCCTGCTAGTGGCTTTGGATTTGGT GATGCTGTCATAGTGGAATTGCTAAAGGAGAAGGGTCTTCTGCCAGAACTCAGCCTGCAA GTAGAAAACATTGTGTGTGCTCTGGATCCTGGACTTCAAGGAGCCGCTGCCACAGTTGCC ACCATACTCAGGGGAAAAGGTCAAAGTGTTGATTTAGTCTTGGAGAACAAACCGCTCAAA TGGGTATTCAAGCGTGCAGCAAGAATAAATGCTAATAGGTTGATATTGGTGGGAGATTCA GAGTGGCAAAGGGGTATGGTGGGTGTGAAAATCCTTTCTTCCGGTGAACAACATGAGATC AAACTTGATGAACTCGAGTGA
PEP MLSSAVSSSLLILHKPLARVIRFPIPKLPLSPNPRPLSSLSPAASALTPNAVGSGGRSGA LSPAPITEDLQKIDVNPPKGTRDFPPEDMRLRNWLFYHFREVSRLFGFEEVDFPVLESEA LYIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGTEKSKLKFKLESEILGD ACEAVADLKQLFSLAEKFGYSEWIQFDASIVRGLAYYTGIVFEGFDRGGKLRAICGGGRY DRLLSTFGGDDIPASGFGFGDAVIVELLKEKGLLPELSLQVENIVCALDPGLQGAAATVA TILRGKGQSVDLVLENKPLKWVFKRAARINANRLILVGDSEWQRGMVGVKILSSGEQHEI KLDELE


| Top |