Cherry SNP DataBase

Gene information

Gene Pav_sc0000584.1_g320.1.mk
Chromosome name PAV_r1.0chr4
start 12152769
end 12155200
PAV_r1.0 name Pav_sc0000584.1
start 160352
end 162783
direction +
Annotation NR PREDICTED: F-box/LRR-repeat protein At4g14103-like
Sequence CDS ATGGGTTCGAATTCAAAGTCTCGTGAAGCATGCCATGAAGATAGGATCAGTGGATTACCA GATGCAATCATTTCCCATATTCTCTCCTTCCTTTTGACAAGAGAGGCTGTGAGGACCAGT GTTTTATCACACAGGTGGAAGAATCAGTGGACTTCTGTTCCAAATCTGTACTTGCGTGAC AGAGAATATTATCCATTAGAAAGACGTTTGAAAAAATCTGATCCAGATGGCTTCTCCGGG TTTGTGGATCGGGTACTTTTCTTTCGTGGCTCCTCCAGCATTCATAGATTCCGCCTTTTG TGTCTGGAAATGAAGGATTTTTCTCGTATTGATGCTTGGATTCGCACTGCCATTATGCGT AATGTTGTCGAACTCGACCTTGAGCTGTACGAGTACTCGAATCCACCGCAGCCTTTCGTG TTGCCTAGAAGCCTTTTCATGTGCAAAACACTGGTGGTTTTGAAGCTGAGGCTGCAATCA AATTTTATTGCCCTTGCACCTGCCTCAGATTGTTTCCCAAGTCTCAAGTTCCTCCATGTT GATGTCGTGCTTCCTGATGCTGACTCAATGGAGAAGCTCTTTTCATGTTGCCCTGCTCTT GAAGATTTGGTTATAGAGGGAGAACCTGGATATGATTCAGTGCTGACTTTTGAAGTCTCT GCACCGAAACTAAAAAGATTAAGAATAAGTTGGTATATCGTTCCATTTCATCGAAATTAT GATCGAAAAGTTTTTATTAATGCTAATGTTCCAAGCCTGGAAGAGTTTAATCTGCAGGAG AATATTTTGGCAAACTATTCCCTGAATAATGCACATTCCCTAAGCAGGGCCAAGATTGAT TTGGTAAACCTGCATTCTGGGGAGAAGTTTGGCACTGTCCGTGATTCTGCCGATCACATA CAATGGCTCTTTGCCGAAATTCGCAATGTTAAATTTCTGTCACTTTCAGCTCCAGTTTTC GGGGGTCCCTGCAGCGTGTATCAATATCATCTCCCAACATTTAACAATTTGAACCAGTTG GAGTTACTTCTTCAAAATTGCTGCTCGTTGCGATCGGTCACAAATTTTCTGCAGATATCT CCCAAATTGGAACATCTAGTCTTTGAGAATAGCATCCACTGTTATGTGTGCCATTTCGTG GACGAGTCAGTACATGAATGGAGTCCACCAGATTTTGTGCCTGCTTGTTTGTTGTCACAC CTCAAGACTATTCGCATACGGGGATTCCAGGGGCTGCCGGATGAGATGGAAGTGGTGGAG TACTTGTTAAAGTACGGTGCTGTTGTGAACACCATGACAATTTGTACCCTTGAGTATTTC TGTGAAGAAAAAGAGATGAAGTTCCCTTTGCTAGGTCTGAGAGAAGAGGTAAAGTTGTTG CAGACAATTTCAAAGTTCCCAAGGGCTTCAAAGACTTGTCAAATTGTATTTCCCAAACTC AAATGA
PEP MGSNSKSREACHEDRISGLPDAIISHILSFLLTREAVRTSVLSHRWKNQWTSVPNLYLRD REYYPLERRLKKSDPDGFSGFVDRVLFFRGSSSIHRFRLLCLEMKDFSRIDAWIRTAIMR NVVELDLELYEYSNPPQPFVLPRSLFMCKTLVVLKLRLQSNFIALAPASDCFPSLKFLHV DVVLPDADSMEKLFSCCPALEDLVIEGEPGYDSVLTFEVSAPKLKRLRISWYIVPFHRNY DRKVFINANVPSLEEFNLQENILANYSLNNAHSLSRAKIDLVNLHSGEKFGTVRDSADHI QWLFAEIRNVKFLSLSAPVFGGPCSVYQYHLPTFNNLNQLELLLQNCCSLRSVTNFLQIS PKLEHLVFENSIHCYVCHFVDESVHEWSPPDFVPACLLSHLKTIRIRGFQGLPDEMEVVE YLLKYGAVVNTMTICTLEYFCEEKEMKFPLLGLREEVKLLQTISKFPRASKTCQIVFPKL K


| Top |