Cherry SNP DataBase

Gene information

Gene Pav_sc0000584.1_g720.1.mk
Chromosome name PAV_r1.0chr4
start 11933227
end 11934268
PAV_r1.0 name Pav_sc0000584.1
start 381284
end 382325
direction -
Annotation NR PREDICTED: seipin-like
Sequence CDS ATGTGGAGTGTCACATCTACAAATGTCATTTTAGCTGTATCTGAGCGCTTGCAAGCCCAA AAGTCACTTGCAGTGAATGTAGGTTTGGCCTTCTTCAGGTCAATCCATCACCTAGTTCAG AACCCAATTCAGACCACAGAGATCCTGAACTTTGATTACACCAAATCAAGTCCAGTATCT TTTGTTCCCCTCATGTCATCTTCTGGTGCTTGTGGTGACCGTGTTATACCTTATAATCAC AAACTGCAGCTTGCTGTTTCATTGACCATGCCTGAATCGGAATACAGTCACAAACTAGGT GTCTTTCAGGTAAGGGTAAAATTCTTGTCAGCAAATGGCATTGTCACTGCTAGTTCAAGC TATCCCTGCATGCTGCGATTCAAAAGTGGACCAATTCGTGTCATTGAAACCTTTCTTAGA AGTGCTCCTCTTATTGCTGGTTTACAATCAGAAACCCAAGTGACACTAGAACAAAGAGCA GAGTTCCAATCTGTTGCCGGCATACCTCAAATATATGCTGGATCATTAGTGCTTCAATCT GAGCTTCCTCAGCTGAGAAGGTTTGTATGGTGTTGGAGGAGAACAATATTTGTGTGGACA ACATTTAAAAAGTTAATCACTCTGGCACAAAAGCAGCTTAGTGTTTCCATGGAAGATTAC GAGGATATAGCAGCTAAGTGTTTCTAA
PEP MWSVTSTNVILAVSERLQAQKSLAVNVGLAFFRSIHHLVQNPIQTTEILNFDYTKSSPVS FVPLMSSSGACGDRVIPYNHKLQLAVSLTMPESEYSHKLGVFQVRVKFLSANGIVTASSS YPCMLRFKSGPIRVIETFLRSAPLIAGLQSETQVTLEQRAEFQSVAGIPQIYAGSLVLQS ELPQLRRFVWCWRRTIFVWTTFKKLITLAQKQLSVSMEDYEDIAAKCF


| Top |