Cherry SNP DataBase

Gene information

Gene Pav_sc0000588.1_g460.1.mk
Chromosome name PAV_r1.0chr1
start 23456467
end 23460409
PAV_r1.0 name Pav_sc0000588.1
start 279933
end 283875
direction -
Annotation NR PREDICTED: protein NSP-INTERACTING KINASE 2
Sequence CDS ATGGAGATTAGGAAGGAAGGTAAAGCTTTGTGCTTTGTGGCCCTTTTGTGCTTGTGGACG ACTTCTGTGACTGGTTTGCTTTCTCCAAAGGGTGTCAACCCCGAAGTGCAAGCCTTAATG GGCATTAAAGAGGCTCTGAAGGATCCTCGTGGTGTTCTTAAAAATTGGGATGAAACTTCT GTGGACCCCTGCATCTGGAATATGGTCACTTGTTCTCTTGATGGTTTAGTCATTGGCCTG GGAACTCCAAGCCAGAATTTATCAGGCACTTTGTCACCAAGCATAGGAAACTTGACAAAT CTTCAGCTTGTAACATTTCAGGATAACCATATAACAGGATCAATCCCCACAGAGCTTGGG AAGGTCCAAAAGCTTCAAACACTTGATCTGTCCAGCAACTTGTTCAATGGTCAAATTCCC AGCACTCTATCCCACTTGAAAAGCCTACAATACCTGCGGCTAAACAATAACAGTCTCTCC GGTGCAATTCCTTCATCTTTTGCTAACATGACCCAGCTGGCCTTTCTGGACATGTCTTTT AATAATTTGAGTGGTCCAGTACCCAGGTTTCCTGCTAAAACATTCAATGCTGTGGGAAAT CCTCTGATATGTGTCGCTGGAATAGAGCAAGACTGCTTTGAAACAACGAGGATGCCACCA GCTTTTCCCTCGAATAACTCACAAAATGCTCAACCTGCTGGGAGACCTAGGAGCCACAAA ATTGCCTTAGCGTTTGCCTCAAGCCTAGGCTGCATCTGTCTTCTAATTCTTGGTTTTGGT TTCCTTCTTTGGTGGAGGCAAAAACACAACAAACAGATATTCTTAGATGTTAATGAACAA CATCATGAAGAAGTTTGCCTTGGAAACCTGAGGTCGTTTCACTTCAGAGAACTTCAAGCT GCAACACACAACTTCAGTAGCAAAAACTTGGTTGGCAAGGGTGGTTTCGGAAATGTCTAC AAAGGATGTCTCCGAGATGGTACAGTAATAGCAGTCAAAAGGCTCAAGGATGCTAATGCC ATAGGCGGTGAAATCCAATTTCAGACAGAACTTGAGATGATCAGCCTAGCAGTGCATCGC AACCTTCTCCGGCTTTATGGATTTTGCATGACAGCCAAAGAGAGGCTTTTGGTTTATCCC TACATGTCCAATGGTAGTGTTGCTTCACGTCTCAAAGTTATGATTAAACACAAAAAATTG GTAAAGAAAATCCAACATGAAAAGAAGTTTGATGTGCTAGTTGACAAGGAACTGAAGAAT GACTATGATCCAATTGAGCTCGAAGAAATGATTCAAGTAGCTCTCTTATGTACTCAAAAT CTTCCCAGTCAAAGACCCAAGATGTCCGAAGTCGTTCGAATGCTTGAAGGAGATGGACTT GCAGAGAAATGGGAAGCTTCTCAGAGAGCTGAATCAAATAGGTGCAGAGCCAATGAATTT TCCTCGTCCGAGCGCTACTCTGATCTTACTGACGACTCTTCATTGCTTGCACAAGCAATG GAGCTCTCTGGACCAAGATAA
PEP MEIRKEGKALCFVALLCLWTTSVTGLLSPKGVNPEVQALMGIKEALKDPRGVLKNWDETS VDPCIWNMVTCSLDGLVIGLGTPSQNLSGTLSPSIGNLTNLQLVTFQDNHITGSIPTELG KVQKLQTLDLSSNLFNGQIPSTLSHLKSLQYLRLNNNSLSGAIPSSFANMTQLAFLDMSF NNLSGPVPRFPAKTFNAVGNPLICVAGIEQDCFETTRMPPAFPSNNSQNAQPAGRPRSHK IALAFASSLGCICLLILGFGFLLWWRQKHNKQIFLDVNEQHHEEVCLGNLRSFHFRELQA ATHNFSSKNLVGKGGFGNVYKGCLRDGTVIAVKRLKDANAIGGEIQFQTELEMISLAVHR NLLRLYGFCMTAKERLLVYPYMSNGSVASRLKVMIKHKKLVKKIQHEKKFDVLVDKELKN DYDPIELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDGLAEKWEASQRAESNRCRANEF SSSERYSDLTDDSSLLAQAMELSGPR


| Top |