Cherry SNP DataBase

Gene information

Gene Pav_sc0000588.1_g480.1.mk
Chromosome name PAV_r1.0chr1
start 23466829
end 23469932
PAV_r1.0 name Pav_sc0000588.1
start 290295
end 293398
direction -
Annotation NR PREDICTED: S-adenosylmethionine decarboxylase proenzyme
Sequence CDS ATGGCCATGGCGGTCTCTGCAATTGGATTTGAAGGTTTTGAAAAGAGGCTAGAAATATCA TTTTTTGAACCGAGTATCTTCGTTGATCCTGAAGGAAGGGGTCTTCGATCTCTGGCCAAA GCTCAGATAGATGCTCTTCTTGACGAAGCTGAATGCACTATCGTCTCTTCATTGTCAAAT GATCATGTGGACTCCTATGTTCTTTCTGAATCAAGCCTCTTTATTTATCCGTACAAGATG ATCATCAAAACTTGTGGGACAACCAAGTTGCTCCTTGTGATCCCGCCTCTCCTGAAGTTG GCTGAAACCATTTCCCTTGCTGTGAGATCTGTGAAGTACACTCGCGGTAGTTTCATTTTT CCAGGGGCACAGTCATACCCTCATCGTAACTTCTCAGAAGAAGTTTCTGTCCTTGACGGC TACTTTGGAAAGCTTGGTTCAGGAAGCAGGGCGTATGTGATGGGCCGTTCAGATGGACCT CAGAAATGGCATGTGTATTCTGCTTCTGCTGAATCAGGAAGCTTCGCTGACCCTGTTTAC ACTCTAGAAATGTGCATGACTGGTTTGGACAGGGAGAAGGCTTCTGTGTTCTACAAATCC CAATCAAGCTCTGCAGCTGCAATGACAAACGATTCTGGTATCCGAAAGATCCTTCCAGAT TCTGATATTTGCGATTTCGAGTTTGACCCCTGTGGTTACTCCATGAATTCCATTGAAGGA GCTGCAATTTCGACCATTCATATTACACCCGAAGATGGTTTCTGTTATGCAAGTTTTGAA ACAGCTGGATATGATCTGAAAGATGTGAATATCAACCAGTTGGTTGAGAGGGTCCTGGCT TGTTTCCAACCGAGGGAGTTCTCCATTGCTGTGCACGCTGATGTTGCTACCAAGTCACTC CAGCAACTATCTTCAGTGGATTTGAAGGGATACTGTCGCGAAGAGAGCAGCCACGAAGAA CTTGGAATGGGTGGTTCCATTGTCTACAATAGGTTCCTCAAGACTGAGCGCTGTGGTTCT CCTAGATCAACTCTGAAAGGCTGCTGGAGAGATGAAGAAGAGGAAGAAGATTAA
PEP MAMAVSAIGFEGFEKRLEISFFEPSIFVDPEGRGLRSLAKAQIDALLDEAECTIVSSLSN DHVDSYVLSESSLFIYPYKMIIKTCGTTKLLLVIPPLLKLAETISLAVRSVKYTRGSFIF PGAQSYPHRNFSEEVSVLDGYFGKLGSGSRAYVMGRSDGPQKWHVYSASAESGSFADPVY TLEMCMTGLDREKASVFYKSQSSSAAAMTNDSGIRKILPDSDICDFEFDPCGYSMNSIEG AAISTIHITPEDGFCYASFETAGYDLKDVNINQLVERVLACFQPREFSIAVHADVATKSL QQLSSVDLKGYCREESSHEELGMGGSIVYNRFLKTERCGSPRSTLKGCWRDEEEEED


| Top |