Cherry SNP DataBase

Gene information

Gene Pav_sc0000600.1_g370.1.mk
Chromosome name PAV_r1.0chr4
start 6078474
end 6080916
PAV_r1.0 name Pav_sc0000600.1
start 214250
end 216692
direction -
Annotation NR hypothetical protein PRUPE_ppa025548mg
Sequence CDS ATGAGGAAGGAGGGCCCACCATCCTCCGTCCCCGTCGGCCCCGTCGCTAAACTATTCGGC AGCTGCTTCGAGAGAAAGCCGTTGGTGCTCACATTGCTTGCTCTCACCTTCGTCATGCTC ATCTGGAACCTCCCTCCCTACTACCAAAGCCTCCTCTCCTCCTCCTCCTCCTCCGCCACT GCATTAACTGCCAATGCATCTCTGCGAGCTGTTTCTTCTTCTTCAATTAACCCATCAGTG ACAGAGCAGAAGCTTTCCACCCCAAAACCCAACGACCCCAACAAGCGCGTCTTTCAGTCA TACGGCAACGCCGCCGCCCTCTTCGTCCAAATGGGGGCCTACCGCGGCGGCCCCACCACA TTCGCCGTGGTAGGCCTCGCCTCCAAGCCCATCCACGTCTACAGCCGCCCCTGGTTCAAG TGCGAGTGGATCTCCTCCAACGGCTCCTCCACTCGCGCCTTGGCCTACAAGATGCTCCCC GATTGGGGCTACGGCCGCGTCTACACCGTCGTCGTCGTCAATTGCACCTTCCCCGTCAAT CCCAACCACGACAATTCGGGCGGCAAGCTCAGCATCAACGCCTACTACGGCGAAAATCCC AGAAAGATGGAGAAGTTCACGGCATTGGAGGAAGCTCCGGGGGCTTACAACGAGTCCAAG TACCGCCCACCTTACCAGTACGAGTATTTGTATTGCGGGTCGTCTCTGTACGGGGACCTG AGTGCGGCGAGGCTGAGGGAATGGATGGCATATCACGCGTGGTTCTTCGGAGAGAAGTCG CATTTCGTGTTCCACGACGCGGGTGGGGTGTCGGATGAGGCAAGGGCAGTACTGGATCCG TGGGTGAGGGCCGGGAGGGTGACAATGCAGGACATCAGGGCTCAGGCGGAGTTCGACGGC TATTACTACAACCAGTTCTTGGTGGTCAATGACTGCCTCCATAGGTACAGATACGCTGCC AACTGGACTTTTTACTTCGATGTGGATGAGTACATATATTTGCCCCATGGCAACAGTTTG GAATCTGTTCTCAGTGACTTCTCCGATTATACCCAATTCACTATTGAGCAGAATCCAATG TCCAGTGCGCTCTGCCTCAACGATCCCACCCAAGATTATTCCAGGCAATGGGGGTTCGAG AAGCTGCTATTCAGGGACTCGAGAACAGGGCTCCGTCGGGACAGAAAGTATGCAATTCAG GCAAAGAACGCCTTCTCGACGGGAGTACACATGTCCGAGAATGTGACTGGAAAAACATTG CACGACACAGAGACTAAGATCCGTTATTATCACTACCATAATTCTATAACCGTACAGGGT GAGCTCTGCAGGGAGTTGGTGCCAATGTCGGCCAAGAACAACGTCACATGGTTCAATAAG CTCCCGTACGTCTACGACGACAACATGAAGAAGCTGGCATCCACCATCAAGCAATTCGAG CTCGAAACCATTGGCAATGTACAGGAACAGCAGTTCCCTCAACCTCAACCTCAACCTGAG CCTGCCCACATGAACAATATTAATACTCCAAGGACAACGCATACATAA
PEP MRKEGPPSSVPVGPVAKLFGSCFERKPLVLTLLALTFVMLIWNLPPYYQSLLSSSSSSAT ALTANASLRAVSSSSINPSVTEQKLSTPKPNDPNKRVFQSYGNAAALFVQMGAYRGGPTT FAVVGLASKPIHVYSRPWFKCEWISSNGSSTRALAYKMLPDWGYGRVYTVVVVNCTFPVN PNHDNSGGKLSINAYYGENPRKMEKFTALEEAPGAYNESKYRPPYQYEYLYCGSSLYGDL SAARLREWMAYHAWFFGEKSHFVFHDAGGVSDEARAVLDPWVRAGRVTMQDIRAQAEFDG YYYNQFLVVNDCLHRYRYAANWTFYFDVDEYIYLPHGNSLESVLSDFSDYTQFTIEQNPM SSALCLNDPTQDYSRQWGFEKLLFRDSRTGLRRDRKYAIQAKNAFSTGVHMSENVTGKTL HDTETKIRYYHYHNSITVQGELCRELVPMSAKNNVTWFNKLPYVYDDNMKKLASTIKQFE LETIGNVQEQQFPQPQPQPEPAHMNNINTPRTTHT


| Top |