Cherry SNP DataBase

Gene information

Gene Pav_sc0000618.1_g330.1.mk
Chromosome name PAV_r1.0chr3
start 17733156
end 17737444
PAV_r1.0 name Pav_sc0000618.1
start 179270
end 183558
direction -
Annotation NR PREDICTED: rhomboid-like protease 1 isoform X1
Sequence CDS ATGGGAGAATTCATGGCTGTGGTTCCAATATGCTACAAAATCCCATACAAAGGCAATGCT CAACTGAATCATTATGCAATGAGACAGAGTGGTATGTCCAGCAATATGTGCAGGAATTGG CATATTACTTCATTTCTTAGCACTGATGTGTTGACACAAAAGAAGACAAGAGAGGCAAGT TTCATTTTAGCAAATAATGAAAGAAAGCAGAATATAGGCATGGTTTGGTATGCATCAGAT TCTGGTACAAATGAGAAGCAACTCAGATCTTTAGATTCCTATCTTGGGAAACTCCAAAAT GGCACAAATCTGCCTGCAGATAAGTCAAACAGGACAAGGGAGCCACTCACTAGAAATGGT CAGTTGAGATTAAAGAAGGGGTTGGAGTCTCTTGATGATTATTTTGGAAAACTTAATAAA GATGGAGTCTCAGAGAATTATACATCTAGTTCTGTTGATCTTACTGAAGACAATCCTACT GAAAAACTATCATCTATCAATCAAGATTCTGAAAAATCTGATGAGAGGGAAGAACAGAAG AGCTACAGAAATCCTGTAAGTACAAGGGATGATCATGGTCCTCAGAGTTCTCAAGATTCA CTGCAGTATAATGAAATCTCTGATCTCTACTTAATAAGCATATTGGGTTCTATAAACATT GCAGTTTTTCTGTTTGAGATAGCAAGTCCAGTTAGGACTTCTGACTTAGGGCTCTTTTCT CTTCCATTACTATATGGAGCAAAGATAAATGATTTGATCCTGGTTGGAGAATGGTGGAGG CTTGTGACACCCATGTTTCTGCACTCAGGACTCTTTCACATAGTCGTTGGCTGTTGGGGG CTTGTGACATTTGGGCCTAAAGTGTGTAGAGGCTATGGTTCATTTACATTTTTCTTGATT TACATACTTGGAGGAATCTCTGGCAACTTGATTAGCTTTCTTCATACACCAGAGCCAACT GTTGGTGGAACAGGACCAATATTTGCCATGATGGGAGCTTGGCTCACTTATCAGGTCCAG AACAAAGACATAATTTCAAAGGAAGTTTCAGAGAGCATGTTCCGAAAGGCGGTAATAACT ACGCTTCTTAGCTTCACATTGAGCAGTTTTGGTCCAATCGATGACTGGACACATTTTGGA GCTGCATTTACAGGCGTGGCATATGGGTTTTTGACATGCCCAACTCTTCAACTGGACGAT GCATCATCTTCAACAAGTGGCCAAGAGGAAGGCATCACACTTGTCAGACGTTATGCTGAT CCATGCAAATCACTGTTTTTCTTTACCTTGTTTGCTCTTGTTTTAACTTGTTTGCTTTTC TTTGTTGAGCCTCCACTGAATGTCATTGCATCAGACCCTTCTTTGATTGGTAGAGGCTTA ATGTCTCCCCTTATAGCAGTGAACTTGGTGGTCCATCTGATCATGCTTGGACTTGCTGGA TGGTCTCTTGATAAGTACATCAATGGAGAGCAAAATCACCCTCATCTGGGAGGAAACCCA TCAACAAGCTTTGTGTTGATCTCTGCATTGATAGCAGGGGTTGTTGCTTGTTCTATGCTC AATGGGTGGATGCATCTTCGGATATGGGGAACTGATAGTCTAGCTGCTGCTTCTTCTTCA GCTATCATAGCCCAGGCTATTATTGCCCTCGCTTTCGGTTTCGTATGTAAGGAGATCATA TTAGGTGGACACAGAGGAAAACGCTTGCAAACATTGGAAGCTATGATTGCAATATCACTA CTAAGTCAATTGATGTACCTGGTGCTTCTGCATGCTGGGATGTTTAAGAGCAGATATAGA TCAGGTGGAATTGCCATGGGTCATCACCCCCGAACCACCGGCACGACAATTGTTATCTGA
PEP MGEFMAVVPICYKIPYKGNAQLNHYAMRQSGMSSNMCRNWHITSFLSTDVLTQKKTREAS FILANNERKQNIGMVWYASDSGTNEKQLRSLDSYLGKLQNGTNLPADKSNRTREPLTRNG QLRLKKGLESLDDYFGKLNKDGVSENYTSSSVDLTEDNPTEKLSSINQDSEKSDEREEQK SYRNPVSTRDDHGPQSSQDSLQYNEISDLYLISILGSINIAVFLFEIASPVRTSDLGLFS LPLLYGAKINDLILVGEWWRLVTPMFLHSGLFHIVVGCWGLVTFGPKVCRGYGSFTFFLI YILGGISGNLISFLHTPEPTVGGTGPIFAMMGAWLTYQVQNKDIISKEVSESMFRKAVIT TLLSFTLSSFGPIDDWTHFGAAFTGVAYGFLTCPTLQLDDASSSTSGQEEGITLVRRYAD PCKSLFFFTLFALVLTCLLFFVEPPLNVIASDPSLIGRGLMSPLIAVNLVVHLIMLGLAG WSLDKYINGEQNHPHLGGNPSTSFVLISALIAGVVACSMLNGWMHLRIWGTDSLAAASSS AIIAQAIIALAFGFVCKEIILGGHRGKRLQTLEAMIAISLLSQLMYLVLLHAGMFKSRYR SGGIAMGHHPRTTGTTIVI


| Top |