Cherry SNP DataBase

Gene information

Gene Pav_sc0000624.1_g090.1.mk
Chromosome name PAV_r1.0chr4
start 18918294
end 18922781
PAV_r1.0 name Pav_sc0000624.1
start 49223
end 53710
direction -
Annotation NR PREDICTED: protein trichome birefringence-like 5
Sequence CDS ATGGCAGTGGCTTCCAATTCCTCAACCCAGAAGAAGCGTTACACTGCCACCACTCTCCTC TTCATCACCCTGTTCCTCTTCACCATCTACCTCTTCAGCAAACGAGCTCTTGAGCCTTCT CTCTCTCTCTACAAAAATCCCTTTCCCCAAATCCCCTCTTCTTCTTCTTCTTCTTCTTCT TCCTCGCTTCCAAATTCCAACCTCTCCTTGCCCAACTCCACATCTACAGAAAGAGTAGCA GTGGACACACCTTCTTCAGGCAGTAATTACCAACCGCCCTTGCTTTATTCTATCTCTGCA CAGCCATTGGACCCACCAACCCAACAACCCGTTTCATCCAATTCACAAACTGAAGAGCCA ACGGAGTTCAATGATGAAACTGAGCAAGACCCAGGTCGTGAAAATGAAAACCCATTTGGT GAAATGGGTGAAATTGGGTGTGATTTGTATCTGGGGACTTGGGTGAAAGATGAGCGTTAC CCGCTTTATAAACCCAGTTCTTGCCCTTATGTTGATGAAGCTTTTGATTGCCAAAGCAAT GGGAGGAGTGACTCTGAGTATCTCAAATGGCGGTGGAAGCCTGAGGGCTGTGATCTTCCA AGGTTTAATGCATCAGACTTCTTGGTGAGACTACGTGGTAAAAGATTGATGCTGGTAGGA GATTCCATGAACCGGAACCAGTTTGAGTCAATCCTTTGCCTCCTCCGCGAAGGCTTGCAT AATAAGAGCAGAATGCATGAAATTCACGGCCACAAAATAACTAAGGGAAGAGGCTACTAT GTTTTCAAATTCGAGGACTATGACTGTACAGTGGAATTTGTGAGGTCGCATTTCCTCGTA AAGGAAGGAGTCCGCATTAATGCTCAAGGGAGTTCAAATCCAACTCTTTCGATAGATCAA ATTGATAAGACAGCTAAACGTTGGAAAAGAGCTGACATTCTTGTCTTTAATACTGGCCAT TGGTGGAGTCATGGAAAGACTGCTCGTGGGAAAAACTACTATAAAGAGGGAGATTATCTT TATCCAAAGTTTGATGCATCTGAGGCCTATAGAAGGGCTCTGAGGACCTGGGCTAGCTGG ATTGATCGTAATGTTAATCCATCAAAGCAGTTGATCTTCTATCGTGGGTACTCTTCTGCC CATTTCAGGTATTAA
PEP MAVASNSSTQKKRYTATTLLFITLFLFTIYLFSKRALEPSLSLYKNPFPQIPSSSSSSSS SSLPNSNLSLPNSTSTERVAVDTPSSGSNYQPPLLYSISAQPLDPPTQQPVSSNSQTEEP TEFNDETEQDPGRENENPFGEMGEIGCDLYLGTWVKDERYPLYKPSSCPYVDEAFDCQSN GRSDSEYLKWRWKPEGCDLPRFNASDFLVRLRGKRLMLVGDSMNRNQFESILCLLREGLH NKSRMHEIHGHKITKGRGYYVFKFEDYDCTVEFVRSHFLVKEGVRINAQGSSNPTLSIDQ IDKTAKRWKRADILVFNTGHWWSHGKTARGKNYYKEGDYLYPKFDASEAYRRALRTWASW IDRNVNPSKQLIFYRGYSSAHFRY


| Top |