Cherry SNP DataBase

Gene information

Gene Pav_sc0000625.1_g130.1.mk
Chromosome name PAV_r1.0chr8
start 11998263
end 12004088
PAV_r1.0 name Pav_sc0000625.1
start 53647
end 59472
direction -
Annotation NR hypothetical protein PRUPE_ppa005719mg
Sequence CDS ATGATGACTGTGAAACAAGGAAAGATACCAAATTTTAGAGCAAAAGCCAGAGTATCTCGC TCTCAGTGGGCAATGGATCCAGTCTCATTCGTGTGGGTCACAGTTGGCAATATTGCTCTC AAGATCCCAGTAGCTTCCAAGCTCGCCCGCTCCGTCGTCCACCCTTCTTCCTCGTCGTGT TTCTGCAAGATCAAGCTCAAAAACCTCCCCCCTCAAAACGCCTCCATCACCTACCTCCCG TCGGAGGCCGAGACCCTTGACAGCACTACTCAAGCCAATGCCATGGCCTCCCGTCGGAGG CAAAAATACTCCCATAAAAATATGCGTTGA
PEP MMTVKQGKIPNFRAKARVSRSQWAMDPVSFVWVTVGNIALKIPVASKLARSVVHPSSSSC FCKIKLKNLPPQNASITYLPSEAETLDSTTQANAMASRRRQKYSHKNMR


| Top |