Cherry SNP DataBase

Gene information

Gene Pav_sc0000636.1_g640.1.mk
Chromosome name PAV_r1.0chr2
start 25193248
end 25204363
PAV_r1.0 name Pav_sc0000636.1
start 263830
end 274945
direction +
Annotation NR PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase 1A isoform X1
Sequence CDS ATGAAAAGCCCGAGGCTAGCCTGTCATTGCCTGATCCTGGGGATTGGGATCCCAATTATA GTGATGAACTTCTTCTGCAAGAAGATGGTTCAGATGTTAGCTGCTTTACTACTGAGTTCA GCCAAGGCATGCATCTTAATTCTGCAGAAAAATTGGTTGGGGCGGGAAGATTTAATCGTG TGTCAAATACGAGCTCAGGCCTATCCTTTCAAAGAGGTGGGTAGCCCTCCTTCAACTAAT GAACCACTTGCTGGATACGCACGCTTGCCAAAACCTTCTCATTTTCCACATATATCACAA AATTCTCCAAGCCGGTTGGGACAGCAATATCAGCGGTCCAGTCAAGGAAGACCCACCAAT TCTCGTGTTGGTGATTGGAATCATATGAAGGTGCAGGCTCCTCCTCCCAATTTTAATTCT GGTGGCCCACTTTCTCCGGGAAATAGCTCATTCGGCAACGGCATGTCATGGGGGCGTAGA GCCAGTCATCCTGTCACTAGCATTCCACCTGCATCCCGAGGAAGAAAGGACTATGGAAGG ATTGCCTAA
PEP MKSPRLACHCLILGIGIPIIVMNFFCKKMVQMLAALLLSSAKACILILQKNWLGREDLIV CQIRAQAYPFKEVGSPPSTNEPLAGYARLPKPSHFPHISQNSPSRLGQQYQRSSQGRPTN SRVGDWNHMKVQAPPPNFNSGGPLSPGNSSFGNGMSWGRRASHPVTSIPPASRGRKDYGR IA


| Top |