Cherry SNP DataBase

Gene information

Gene Pav_sc0000637.1_g010.1.mk
Chromosome name PAV_r1.0chr4
start 6379583
end 6406702
PAV_r1.0 name Pav_sc0000637.1
start 3343
end 30462
direction +
Annotation NR PREDICTED: cyclic nucleotide-gated ion channel 1-like
Sequence CDS ATGTCCTTACCGCGCTGTGTTGATCATCTGACCAAAATCGTAAGCGACGCACCAGGTAAA CTGACACGATGTCTCCCATCCAAAGTTAGAGAACTTTTAACAAAGAAATGGGAAAGAACA CATCTTTCAGCTTCATTTTGGAACAAGATGATTGTAATTTCATGTGTTATTGCAATTTCC CTAGATCCCTTGTTCTTATACATTCCATTCATCGATGAGGAAAAGAAATGCCTTGGAATG GACAACGGGTTGTGGAATGTGGTTCTGATTTTGCGATCTGTAACGGATATCACTTTCGTG GTGGATATTGGATATCAAATCTATGAAGGGCTTAATCAAGCCTACAAGGAGATCAACGGA AGGAAGTCGGACTGGCAAAAGGATTGGCAACCGACGTTAATAAGAAGAGATGAGATAATT CCATTTGCTAAGATTTTCGCTCGGGATTTGACGTGGCGTCCTTTGGTGACTGACCTTCTC TCTGCTTTTCCCATGCCACAACTTCTAATGAAAGTTTTTTTCAAAATGTGGTGGTCGGGA TATTCAGAACCGAGAAAGGTTGTCAACTTTTTTCTTCTCATCCAATATCTGCCAAGAATT TATCGAATTATCTTAGCTTCTTCCGAACTTACAAGGACCATCAGAATACCGATCAAAGCT ATATTCAATTTCTTTTTATACATTCTTGCTAGCCATGTTATTGGAGCCTTTTGGTACTTC TATTCCATTGAACGAGAGACCCTCTGTTGGCACCAGGCTTGTCAAAATCAAATAGATCCC GAGAGATGCATGAGTACCTTTTATTGTGATCATGACAATTCTGCCCAACCAAATATTACA TTTTTTGATGAACATTGCAACATAGATGTTCCATACAATGCTACAGAGCCGTTTAAGTAT GGAATATTTCTTGATTCCCTTAAGTCTGGTATTGCGGGGAATAAACATTTTCCAACAAAG TTATGCTACTCCTTCTGGTGGGGTCTGAGAAATTTGAGCAACTTTGGCACGAATCTCGCG ACAAGTAGTTCTCTGTGGGAAAACTTGTTTGCAATTCAAATTTCTATCACTGGCTTGCTA TTATTTGTATATCTCATTGGAAATGTTCAGACATTCATTCAGATGAGAACCACACAATCT GAGGAAATTAGGAAGAAGATTGAATTTAAAAAAGAAGCGACAGACATGTGGATGGAGAAA AATGCCATTCCTGATGATAAAAGGAAGGAAATCAGGAAAATGATAAAAAGAAGCGACAGA CACCTGGAAGGGGACAAAGATGCTGTTTTGGAGAATCTATTCAATGTTGTTCCCGGTTAT ATGCAAAAATTCCTAAAGCATTTTCTCTGCATGAAAATTCTAAAAGAGGTTGATCTCCTT CAACTTATGGATGACAGTGTGCTGAAAATGATGTGCGACTGTCTGAAGCCAGTGACGTAC GCGGTAGATCACATCATATTTCCAAAGGAGCACCCAATTGACCGCATGCTTCTCATTATA AAAGGCACTGTATTGACCTACAGCATAACTCCTATTCCTAGCCTTACACCTGGTGAAGAA ACAACAAAAGATTCTGGTGCTGCCCCATCAATGGCCACCAAGCAACTTGGGAAAGGTGGT GTTTATGGAGAAGAGCTTCTGACGTGGGCATCGCCCGAGAAAACTGGGATTGACAACCTT CCTACCAGCAACGAATATGTGAAATGTCATACAAAAGTAGAAGGCTTTGTTCTCTCAGCC CAGGACTTGCTAAAGGTAGTCTCCAAATCCAAACAGTTGTGGAAGTTAAACATAGGCCCT TGA
PEP MSLPRCVDHLTKIVSDAPGKLTRCLPSKVRELLTKKWERTHLSASFWNKMIVISCVIAIS LDPLFLYIPFIDEEKKCLGMDNGLWNVVLILRSVTDITFVVDIGYQIYEGLNQAYKEING RKSDWQKDWQPTLIRRDEIIPFAKIFARDLTWRPLVTDLLSAFPMPQLLMKVFFKMWWSG YSEPRKVVNFFLLIQYLPRIYRIILASSELTRTIRIPIKAIFNFFLYILASHVIGAFWYF YSIERETLCWHQACQNQIDPERCMSTFYCDHDNSAQPNITFFDEHCNIDVPYNATEPFKY GIFLDSLKSGIAGNKHFPTKLCYSFWWGLRNLSNFGTNLATSSSLWENLFAIQISITGLL LFVYLIGNVQTFIQMRTTQSEEIRKKIEFKKEATDMWMEKNAIPDDKRKEIRKMIKRSDR HLEGDKDAVLENLFNVVPGYMQKFLKHFLCMKILKEVDLLQLMDDSVLKMMCDCLKPVTY AVDHIIFPKEHPIDRMLLIIKGTVLTYSITPIPSLTPGEETTKDSGAAPSMATKQLGKGG VYGEELLTWASPEKTGIDNLPTSNEYVKCHTKVEGFVLSAQDLLKVVSKSKQLWKLNIGP


| Top |