Cherry SNP DataBase

Gene information

Gene Pav_sc0000638.1_g320.1.mk
Chromosome name PAV_r1.0chr6
start 147981
end 159836
PAV_r1.0 name Pav_sc0000638.1
start 147981
end 159836
direction +
Annotation NR PREDICTED: ABC transporter G family member 31
Sequence CDS ATGTGGGCGGCGATCGCGAGATTGCCGTCGCAGAAGCGATCGAACATGGCGCTGCTGAGG AAGAAGGGCTCCGATAGGCAGGGCGGCGCTAAGACGGAGACGGTCGACGTGCGGAAGCTC GATAGGACGAATCGCGAGCTCGTCGTCAAGAAAGCTTTGGCCACCACCGATCAGGATAAC TTTCTTTTGCTCTCCGCCATTAAAGAACGCCTTGATAGAGTCGGATTGGAAGTCCCAAAG GTTGAAGTGCGGTTTGAGAACCTGAAAGTCGTGGCAAATGTTCAAACTGGATCAAGAGCT TTGCCTACTCTAATTAATTTTACTCGTAATTTGTTAGAGAATGTTTTGACTGGTTTGAGG ATCTTTCGACCCAAGAGACACTCTTTAACCATTTTGAATGACGTTAGCGGGAAAACTGGT AGCATTACCTACAATGGCCACAAGATGAACGAGTTTTGCGTTCAAAGAACTTCTGCTTAC ATCAGCCAAACAGATAATCACATTGCAGAGCTGACTGTAAGAGAAACCTTGGACTTTGCA GCTAGATGTCAAGGTGCAAGCGAAGGTTTTGGAGCATACATGAAAGATTTGGAACGGGTA GAGAAGGAAAGGGACATAAGGCCGGATCCAGAAATTGATGCATATATGAAGGCATCATCT GTCGGCGGTAAAAAGCACAGTGTTTCAACAGATTATGTTTTGAAAGTGCTTGGTCTTGAT GTATGTTCAGAGACAATTGTTGGAAACGACATGCTAAGAGGCGTATCAGGTGGACAAAAG AAAAGAGTTACCACAGTGCACCAAATGGCTTTGGGTCTCTTTCGGATGATGGCGGCTATT ACAAGGGATATGGTCATTGCCAATACATTCGGATCAGCTGCACTACTAATTATATTTTTG TTGGGTGGATTCATTATTCCGAAAGCAAGCATTAAGCCATGGTGGGTTTGGGGCTTTTGG GTATCACCACTATCTTATGGGCAACGTGCTATTTCCGTCAATGAATTTTCTGCTACAAGG TGGATGAAGAAATCTGCTATTGCACTTAGGAAAGCCCAGACAGTGATTCTCGTTGACGAC ACAGAAGGGAGTCCTCCTGCAGATGTGGACGGTAACAAAGAATCAGATCCAACATCAGCT GGAGATAACAGCCCAAAAAAGGGAATGATCTTACCATTTCAGCCATTAACAATGACTTTC CATAATGTCAATTACTTTGTTGACATGCCAAAGCTTCTTCTTATGAAACGAGGGGGGCAA GTTATATATGGAGGAAAGCTTGGTTTGCACTCACAGACAATGATAAACTATTTTCAGGGC CTTGTAGAGATCCCATACATTGCTGTACAGACAATAATATATGGCGTAATCACTTACTTC ATGGTTAACTTCGAAAGGACACTTCGAAAATTTTTGCTCTATATTGTGTTCTTGTTCCTC ACATTCACCTACTTTACCTTCTATGGTATGGCGGCTGTTGGTCTTACACCTTCTCAACAC TTGGCCGCTGTCATTTCTTCTGCTTTCTACTCTTTGTGGAACCTCCTCTCCGGGTTTCTC GTCCCAAAGCCACATATCCCAGGATGGTGGATTTGGTTTTACTACGTCTGCCCGGTTGCA TGGACACTTCGAGGTATTATCACCTCGCAACTTGGTGATGTGGAGACCAAGATGGAAGGT ACATTTCAGGGCACTGTGAAGGAGTATTTGGAAGTCAGTCTTGGCTATGGTCCTGGGATG ATTGGAGTTTCAGCAGCTGTG
PEP MWAAIARLPSQKRSNMALLRKKGSDRQGGAKTETVDVRKLDRTNRELVVKKALATTDQDN FLLLSAIKERLDRVGLEVPKVEVRFENLKVVANVQTGSRALPTLINFTRNLLENVLTGLR IFRPKRHSLTILNDVSGKTGSITYNGHKMNEFCVQRTSAYISQTDNHIAELTVRETLDFA ARCQGASEGFGAYMKDLERVEKERDIRPDPEIDAYMKASSVGGKKHSVSTDYVLKVLGLD VCSETIVGNDMLRGVSGGQKKRVTTVHQMALGLFRMMAAITRDMVIANTFGSAALLIIFL LGGFIIPKASIKPWWVWGFWVSPLSYGQRAISVNEFSATRWMKKSAIALRKAQTVILVDD TEGSPPADVDGNKESDPTSAGDNSPKKGMILPFQPLTMTFHNVNYFVDMPKLLLMKRGGQ VIYGGKLGLHSQTMINYFQGLVEIPYIAVQTIIYGVITYFMVNFERTLRKFLLYIVFLFL TFTYFTFYGMAAVGLTPSQHLAAVISSAFYSLWNLLSGFLVPKPHIPGWWIWFYYVCPVA WTLRGIITSQLGDVETKMEGTFQGTVKEYLEVSLGYGPGMIGVSAAV


| Top |