Cherry SNP DataBase

Gene information

Gene Pav_sc0000638.1_g480.1.mk
Chromosome name PAV_r1.0chr6
start 218914
end 221322
PAV_r1.0 name Pav_sc0000638.1
start 218914
end 221322
direction -
Annotation NR PREDICTED: putative serine/threonine-protein kinase-like protein CCR3
Sequence CDS ATGACACTTGTACATCCACCATCTTCTCTCATTATCACCATCATCTTCACAGCCTTCGTA TCTTCACTGACACCGCATGATAGGGTGGTCCATGGCCTTGGCTTAGCTTCTACCACAGCC ATCACATATGGCACTTCCACTGTTTGTGGCATTGTGGCAGACAACCCTACACAGAGCATA CAATGCTACCAAAACATTCAGACCATTTCAGTCCAGCCCATTGTTTCTTTTGAAGCCATC TCTGGGGGCAAGACCTTCTTCTGTGGCCTCAGGTCTGGTGGCTTTAGCCTTCTCTGTTGG GACACCAGCTTATCTAGCTCAAGTAGGTTCCAACCTAAACGCATATATCACAGTGACACA ATAGCCTTGACTCATCTGGCTGTAGGTGATGCCCAAGTTTGTGCCAGAGAGGTCAACTCT AGAATTGTCAGGTGCTGGAGAGGAGGAGATGGCACAAGAGGGTCTTTGTTTCCCTCACCT GGGGAAGCATTGGACTTTCATACAATCACATCTGGAAAGGGGTTTACATGTGGGATTTTG GTGAATGGTAGCAGAGTTCTGTGTTGGGGTCAGAGTAGTGTTGGAGCTGAGATTCAAACA GGGTTTGAGAATGTGTTGATGTCAAGCCTAGTTGTTGGAGAGTCTCATGCTTGTGGGTTT AGTGTGAATGGAGCTTTGGTCTGTAAAGGGAACAACGATTCCGGGCAATTGAATGTACCT TCAAGTACTTCAGCTTTTGAGTTTTCAGGCCTTGCATTGGGATCAAATTTTACTTGTGCC ATTCGTCGAAGAAGTGGCTTTGTTGTATGCTGGGGAGGAAGAAACAGATTTGAATATCAC AGTGATGCTATTGCAAATGTTTCATTTGAGTTGATTGATGCAGGTTTGGATTTTCTTTGC GGCTTAACAACAAGTAATTTATCAATGATTTGTTGGGGACCAGGCTGGTCTAGTTCTCAG AATGATCTTCCACTAGGAATGATTGTTCCTGGTCCATGTGTACAAGGTCCATGCAGTAGC TGTGGTGTGTACCCGAATTCGGAGACTCTTTGCAGTGGTTCTGGGAAAATCTGCAAATCA TGCCAGATTGAACTTCCAATTGCAGTGCCGTTGCCCCCAATAAATCCGCCGCCACCACAA GGTTCATCACCGGCTTCTTCATCATCCATAACCAGAAATAGGCTTTTGTTGGCGTTTGCA ATAGTTGGATCCGTTGGGGCTTTTGCAGGGCTCTGCACTATTATCTTTTGCCTATGGACT AGAAAATGTGGTTCTTGGTTTAACCATCATGATTCTGTGCAACCCACAAGTGCTGTTGCC CCCAATGCAGGTTCTGCAGTTGGGATTGAAAATGATCCTAATGCTCCACCTTCAAGATCA AGTTCCATCAAGGGCTATATAAGCGGCTCATCATCAAAGCATGGAGACAAGACTGAGTCA TTTCACCTAGCAGAGCTTTCCGCTGCTACCAAGCACTTCTCATCAGAAAACAAGATTGGT GCTGGGAGCTTTGGTACTGTCTATAAAGGCAAGCTCTCGGATGGTCGTGAAGTGGCCATC AAGAGGGGAGACACTAGTACCAAGACCAATAAATTTCAGGAGAAAGAGAGCGCATTTGAT TCCGAATTAGCATTGCTGTCCCGGCTTCACCACAAGCACTTAGTGAAGCTAGTGGGATCC TGTGAAGAGAAGGATGAGAGACTTTTGGTTTACGAGTACATGCCGCGGATGATGGCGGGG GAGCTGCAAAGCATTTTGGATCAAAGGGTGGTGCCGCCAGATCCGAATGAAGCTGAAGCA GTTGAGCTGGTGGCTTATACTGCCAGGCATTGTGTGAACTTGGAGGGGAAGGAAAGGCCT AGTATGACTGACATTGTTGCCAATTTGGAAAGGGCACTTGCTCTTTGTGAGGATGAACGT TTTAGCTTCTCTACCACCACAATTTCCCTCCCTTCACTGTGA
PEP MTLVHPPSSLIITIIFTAFVSSLTPHDRVVHGLGLASTTAITYGTSTVCGIVADNPTQSI QCYQNIQTISVQPIVSFEAISGGKTFFCGLRSGGFSLLCWDTSLSSSSRFQPKRIYHSDT IALTHLAVGDAQVCAREVNSRIVRCWRGGDGTRGSLFPSPGEALDFHTITSGKGFTCGIL VNGSRVLCWGQSSVGAEIQTGFENVLMSSLVVGESHACGFSVNGALVCKGNNDSGQLNVP SSTSAFEFSGLALGSNFTCAIRRRSGFVVCWGGRNRFEYHSDAIANVSFELIDAGLDFLC GLTTSNLSMICWGPGWSSSQNDLPLGMIVPGPCVQGPCSSCGVYPNSETLCSGSGKICKS CQIELPIAVPLPPINPPPPQGSSPASSSSITRNRLLLAFAIVGSVGAFAGLCTIIFCLWT RKCGSWFNHHDSVQPTSAVAPNAGSAVGIENDPNAPPSRSSSIKGYISGSSSKHGDKTES FHLAELSAATKHFSSENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTNKFQEKESAFD SELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMPRMMAGELQSILDQRVVPPDPNEAEA VELVAYTARHCVNLEGKERPSMTDIVANLERALALCEDERFSFSTTTISLPSL


| Top |