Cherry SNP DataBase

Gene information

Gene Pav_sc0000646.1_g040.1.mk
Chromosome name PAV_r1.0chr1
start 17812192
end 17813390
PAV_r1.0 name Pav_sc0000646.1
start 20247
end 21445
direction +
Annotation NR PREDICTED: delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
Sequence CDS ATGGCGAACTACACAACTCTAGAAATTGTTCAAGAAAACCCAAATTCAGCCGTCTTCTTC CTTTACCTGAATCGCCCAAACCATCGAAACGCTCTATCGCGCGACTTCTTCACCGAATTC CCCAGAGCCCTCTCGTCCCTTGACCAAAACCCAGACGTCAACGTCATCGTTCTCAGCGGC GCCGGCAAGCACTTCTGCGCCGGAATCGACCTCAAAACCCTCAGCGGCGCCGGCAAGCAC TTCTGCGCCGGAATCGACCTCAAAACCCTAACATCGATCTCCGACCAGTTCGTCTCCGGA GACCGAGGCCGTGCCGGAGAGAAGTTCCGTAGAGAAATCAAGGAACTGCAGGAGGCGGTC ACGGCGATCGAGCGGTGCCGGAAGCCCGTGGTCGCATCAATCCACGGGGCGTGCATCGGT GGCGGTGTTGATATCGTGACCGCCTGTGACATAAGGTATTGCAGCAAGGACGCGTTCTTT TCGGTGAAAGAGGTGGACTTGGCGATCACGGCGGACCTCGGGACGCTTCAGAGGCTACCC AGCATCGTCGGGTATGGTAACGCGCTTGAATTAGCGCTTACAGGTCGGACCTTTTCGAGT TCGGAGGCTAAGGAGCTGGGCCTGGTCTCTAGAGTGTTCGGGTCCAGGGAGGAGTTGGAT AACGGCGTACGTGTCGTCGCTGAGGGAATTGGGTTGAAATCTCCACTTGCGGTTAGAGGG ACGAAAGCAGTGTTGCAGAGAAGTAGGGAGCTGAATGTGGAGCAAGGCTTGGATTATGTT GCCACGTGGAATTCGGCGATGTTGTTATCTGATGATTTAAGTGAGGCGGTCTCTGCCCAA GCCCAAAAAAGAAAGCCTGTTTTTGCCAAACTCTGA
PEP MANYTTLEIVQENPNSAVFFLYLNRPNHRNALSRDFFTEFPRALSSLDQNPDVNVIVLSG AGKHFCAGIDLKTLSGAGKHFCAGIDLKTLTSISDQFVSGDRGRAGEKFRREIKELQEAV TAIERCRKPVVASIHGACIGGGVDIVTACDIRYCSKDAFFSVKEVDLAITADLGTLQRLP SIVGYGNALELALTGRTFSSSEAKELGLVSRVFGSREELDNGVRVVAEGIGLKSPLAVRG TKAVLQRSRELNVEQGLDYVATWNSAMLLSDDLSEAVSAQAQKRKPVFAKL


| Top |