Cherry SNP DataBase

Gene information

Gene Pav_sc0000648.1_g220.1.mk
Chromosome name PAV_r1.0chr8
start 15982547
end 15992401
PAV_r1.0 name Pav_sc0000648.1
start 104291
end 114145
direction +
Annotation NR PREDICTED: serine carboxypeptidase-like 20
Sequence CDS ATGTTGGGGGATAAAACCCATGTAGAGGCCATGGATAGGGCTAGTTCTAGTGTTGTCTCC CACAGAGTATTATATTTGTTGCTTTCATTAATTTATGTGTTCTTGAGCTTTTTGCCAACT CAATCAGCTCCTCAGTCTGCTCTCATAACCCAGATTCCTGGCTTCAGCGGCACTCTTCCT TCTAAACACTATTCTGGGTATGTGACAATTGACCGAAATCATGGGAGGAACCTGTTTTAC TATTTCATTGAATCCGAAAGGAAGCCGTCCGAGGATCCAGTGGTTCTGTGGCTGAATGGG CCATTCAATTTTGAAGCAGCCAAGACCAAGGGAAGTCTGCCCCAACTGCACCTTAATCCA TACAGCTGGTCAAAGGTTTCCAACATTATATATTTGGATTCTCCTGCTGGCGTTGGTTTT TCTTACTCAGAAAACAAAACTGACTATTATACTGGTGACCTAAAGACTGCCTCTGATAGC CATACGTTTCTCCTAAAGTGGTTTGAACTTTACCCGGAGTACCTCTCCAACCCATTCTTC ATTTCTGGTGAGTCATATGCTGGAGTCTACGTGCCAACACTTTCTTCTGAAGTAGCGAAA GGAATCGATGCCGGTGTAAAGCCCCTTCTCAACTTCAAGGTATTTATCGGCAGGCAGTCC TTTTGTGAATTTCAAATATCTGTGGCTCCAATCTCAAATTACTGCATAATACAGGGTTAT CTGGTGGGAAATGGAGTTACGGATGATAAATTTGATGGTAACGCTCTTGTTCCATTTGCA CATGGAATGGGACTGATATCAGATGATCTATATGAGGAGGTTAACAAGGAGTGTGGAGGA AACTACATTTACCCAGTCAATGATGCTTGTGGGAGCAAGCTTGAGAAAGTTGACAAGAAT ATAGAAGAATTGAACATATATAACATTCTAGAACCATGCTATCACGGCACAGATTCAATG AAGATTAAGACAACTACAAACAGTAGAGTGCCATCTAGTTTTCGACGGTTGGGTGAGACT GAAAGGCCTCTTGCTGTGAGAAAAAGGATGTTTGGTCGTGCCTGGCCTCTTAGAGCTCCT GTAAGAGATGGAATTGTTCCAACTTGGCCAGAACTTATGAATAGCGAAGACGTTCCATGT ACTGATGATGAGGTTGCTACTTCATGGTTGAACAATGAAACAGTTAGAAAGGCAATCCAT GCAGCAGGGGAAAGCTTGGTACCTAGTTGGGAATTGTGTACTGGCGGAATCAGATTTACT CATGATGCTGGGAGTATGATCAAGTACCACAAGAACCTAACTGCAAAGGGTTATCGGGCA CTTATATATAGTGGTGATCATGATATGTGTGTACCTTTCACTGGGAGTGAAGCATGGACT AGATCACTTGGTTATAAGGTTGTGGATGAATGGAGGCCATGGACTTCCAATGGACAAGTT GCTGGGTATACACAAGGGTACGAAAACAACCTTACCTTCCTGACCGTGAAGGGATCAGGA CATACCGTTCCAGAATACAAACCGCGGGAGGCGTTAGATTTATTTAGCCGGTTTTTGGCT GGACAACCACTATAA
PEP MLGDKTHVEAMDRASSSVVSHRVLYLLLSLIYVFLSFLPTQSAPQSALITQIPGFSGTLP SKHYSGYVTIDRNHGRNLFYYFIESERKPSEDPVVLWLNGPFNFEAAKTKGSLPQLHLNP YSWSKVSNIIYLDSPAGVGFSYSENKTDYYTGDLKTASDSHTFLLKWFELYPEYLSNPFF ISGESYAGVYVPTLSSEVAKGIDAGVKPLLNFKVFIGRQSFCEFQISVAPISNYCIIQGY LVGNGVTDDKFDGNALVPFAHGMGLISDDLYEEVNKECGGNYIYPVNDACGSKLEKVDKN IEELNIYNILEPCYHGTDSMKIKTTTNSRVPSSFRRLGETERPLAVRKRMFGRAWPLRAP VRDGIVPTWPELMNSEDVPCTDDEVATSWLNNETVRKAIHAAGESLVPSWELCTGGIRFT HDAGSMIKYHKNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKVVDEWRPWTSNGQV AGYTQGYENNLTFLTVKGSGHTVPEYKPREALDLFSRFLAGQPL


| Top |