Cherry SNP DataBase

Gene information

Gene Pav_sc0000653.1_g080.1.mk
Chromosome name PAV_r1.0chr6
start 16920167
end 16928253
PAV_r1.0 name Pav_sc0000653.1
start 37155
end 45241
direction -
Annotation NR PREDICTED: E3 ubiquitin-protein ligase UPL4
Sequence CDS ATGGCAAGTCGTGGCCAAAAGCGTACTGAGGTTGACGATGAATTGCCTGCGGATAAGCGA GCGTGTAGTTCTTTGGAGTTTAGACCGAGTTCATCGAACTCGTCTGCTCAAACCCATATG AATTCTATGAACTCCACACCTGAAACCAATGACCATGATATGGACACTACATCCTCTGCT TCAGCGTCTAGCCGGTCCGAGGGAGAACATGAGAAGGATTCAGCATATGGGTCTTGTGAT TCTGATGATGCAGACCCTAGACACAGTGAACTCCGGGACTATCAGAGACGGAGATCTTCG GGTGATCATGGAAAGTTTAAGAGGATCTTATCATCTTTAAGTGAAGAGACTGATCCTTCT GGGCAGTTAGCTGTGCTCACCGAGCTATGTGAAGTCCTATCATTTTGTACAGAGGATTCA CTATCTGGGATGACATCAGACTCATTATCACCACTTCTTGTTCGTCTCGCTAGGCACGAG ACTAACCCAGATATCATGCTATTGGCTATAAGAGCTATAACTTATTTATGTGACGTGCAT CCGAGATCATCGGCCTTCCTTGTCCGACATGATGCAGTTCCTGCTCTTTGCCAAAGACTA ATGGCTATTGAATACTTGGATGTAGCTGAGCAGTGTCTACAAGCATTGGAGAAAATGTCA CGGGAGCAACCACTTGCGTGCTTACAGGCTGGGGCAATAATGGCTGTTCTGAATTATATT GATTTCTTCTCGACAAGCATACAGAGAGTTGCCCTTTCCACGGTGGTGAACATTTGTAAG AAACTTCCTTCTGAATGCCCTTCACCTTTCATGGAGGCTGTTCCTATACTTTGCAATCTT CTCCAGTACGAGGATCCTCAGCTTGTCGAAAATGTTGCTGTTTGCTTGATTAAAATTACA GAACGAGTGAGTCAGTCTACTGAGATGCTGGATCAACTTTGTAAGCACGGGCTGATTCGT CAAGTCACGCATTTTATGAACTTGAATAACCGAGCAACTCTATCCCAACCAATTTGTAAT GTAGGCATTCAACATCATGTTCCTGAGATCCGCCTCTTTTGTATTTTACTGCCTTGGATT GTAGCCTTCAGGACTCTATATGAGCTCAATATAAGCAGCACTTTAAAGGATATATTATCT ACATATGAACTCTCACATGGAATGTCATCTAGTCATGTGGTGGATGGGCATTGCAATCAG GTATATGAAGTTTTGAAGTTGCTAAATGAGCTTCTACCTACTTCAGCTGGAGATCAAGAT GATCCACAGCTGTCAGATAAGGAATCTTTTCTAGTTAATCAACCTGATCTACTGCAAAAG TTTGGGATGGATATACTTCCCTTGTTGATTCAGGTTGTAAATTCTGGTGCCAATTTATAT ATTTGCTATGGCTGCTTATCTGTTATCAACAAGTTAATTTATTTGAGCACATCTGACATG CTTGTAGAACTGCTTCAGAATGCCAACATTTCAAGTTTTTTGGCTGGAGTATTTACACGA AAGGATCCCCATGTGTTGATTTTAGCTCTACGGATCACTGAGCTCATCCTGCAAAAGCTT TCTGATTATTTTTTGGACTCTTTCATAAAAGAGGGTGTCTTTTTTGCCATTGATGCACTG TCAACACCAGAAAAGTGTCAGTTGGTAACCCTGGAAAAATGTTCGAGGCTGGTGTTCCCA GTGTTCAGTGGCACACAGCCTTTGTTTGATCCTAGTCAGAAGTCTGCTTCAAGGGAGGTC CTGAGATGCTTATGTTACGCTTTTGCTACTGGTAAATCACCATCGGTGTCAGAGACAGGA AGCTGCATGCTTGAAAAGGATTCTGTATATAATCTTGCAAAGCATATAAGGACCACGTAC TTTGCACCAGAATTGTATGATTCTGGCAAAGCATTAACTGATGTTCTTCAGAAGCTTAGA AAATTTTCTGCTGCATTAAGTGATTTGAACACATCCATGAATAATGATGCTCTTGATCAG CATGAAGAAAGGTTCTATGGTATAATGCGTCAAGTAATGGAAAAGCTTGGTGGAGGAGAA CCCATTTCCACTTTTGAATTTATTGAAAGTGGAATTCTGAAGTCCTTAATGACTTACCTG TCCAATAGCCAGTACTTGAGACAAAAGGGGGAACTTAGTGCTGTTAACACTGATATCTAT TCTGTAGAAAAAAGATTTGAGGTGTTTGCAAGGCTATTATTTTCTCCTTCAGACCTGCTC TCTGCGGACGTACCCATAATAACATTAATACGGAAGTTACAAAATGCACTATCTTCTTTG GAAAATTTCCCTGTTATTTTGAGCCATATACCCAAGTTAAGAAGTTCATATGCTGCAGTT CCATACGGACGTCGTACAACGTATACATGTATTAGAGTTCGTTTTGTGAAAGACAAAGGG GATACATACCTATGTGATTACTCAGAAGATGTTCTGACTGTTGACCCCTTTTCTTCATTG CATGCCATTCAAGAATTTCTGTGGCCTAAAGTCAATGCGAAAAGAACCAACCACATTAAA TCAGCTACACGAGTTAAGGGGCAGTCTGAAAGTCCACCACTTCAATCACCATCAAATGCA AGCTCTAGTCAAGGGGGAAGCCCACATCCTATGGACCCTGAGAGCATGTCAATGGACTTA CCTGAGTTGCAGGAAACTGTGGAGAAACTAGTGCAATGTCCATCTGATGAGGATACTGAG ATGGAAGAACAGTGTCCTGCATCTTGTAGTAATGAAGATTCTTCTTCGAAACTATTACTT TACCTTGATGGGCAACAGCTGGAGCCGGCATTGACACTATACCAAGCAATTCTGCAACAA CAAATGAAAGAACATGAAATTGTCATTGGTGCAAAACTGTGGAGTCAAGTATACACATTA ACATATAGAAAGGCTGAAGGACAAGATGGTACTCGTAAAGAATGTCTTTATTCAGCCGAA AGTTCTGCTGTATCAGATAAAGTTGGGGTGTATGAATTGTATACTTCGTTTTTCTCCAGC ATGTTTTCTTGTGAGCTTGCTTCTGACTTAGAGAAGTCAAGTCCTACTTATGATATAATA TATCTTCTTAAAAGCTTGCAAAGCATGAACAAGTTCATCTTTTATCTGATGTCTCATGAA AGAATATGTGCTTTTGCTGAAGGGAAAATCAATGACTTGGATAATTTTCAGATGTCAGTT ATTCCAGTGCCACAGAATGAGTTTGTAAGCAATAAATTGACAGAAAAACTGGAACAGCAG ATGCGGGATGCTTTAGCTGTGTCCATTGGTGGTATGCCTTTGTGGTGTAATCAGCTGATG ACATCCTGTCCTTTTTTATTTAGTTTTGAGGTCAAGTGTAAGTACTTTCGGTTGGCAGCA TTTGGTCCACTACTAGTTCAACCTCATTCACCATCGTATAGGGATTCAGGGGTGGCAAGT GACAGGCGTCTAAGCTCTGGAGGCATGCCTCGAAAGAAGTTTTTGGTTTTCCGCAACCAA ATTCTGGATTCTGCTGCCCAAATGATGGACCTGCATGCCAGTCAGAAGGTACTTCTTGAG GTAGAATATAATGAAGAAGTTGGTACTGGCCTTGGTCCAACATTGGAATTCTATACCCTA GTTAGTCACGAGTTTCAGAAGTCTGGTCTGGGCATGTGGAGAGAGGATCATGGGTCTTTT ATATCTGGTACAACCCACGCTGAGGATACTGGAATTTTGATATGTCCTTTTGGTCTTTTC CCTCGTCCATGGTCATCCACTTTGGATACATCTGATGGGATACAGTTCAGTGAAGTAATT AAGAAGTTTGTCCTTTTGGGGCAAATTGTAGGAAAAGCGCTTCAGGATGGGCGAGTCTTG GATCTGCATTTCTCCAAAGCCTTCTATAAACTTATTCTTGGGCAGGAACTTGGTCTGTAT GACATCCAGTCATTTGATCCTGAGCTTGGCAGGACACTGCTAGAGTTTAAGGCTCTTATA GACAGAAAAAAGTTTATGGAATCTGTACATGGAGGAGCAACATTCGAATTTGACTCATGC TTTAGGAAAACCAAAATTGAGGATCTTTGCCTTGACTTTACACTTCCGGGTTATCCTGAT TTTGTTCTTTCTTCTAGGCCTGATAATAAAATGGTAAATATAACAAACTTGGAAGATTAT GTTTCATATGTGGCGGATGCAACTGTAAAGGCTGGAATTACTAGACAATTGGAAGCTTTC AAATCTGGTTTCAACCAGGTTTTCCCTATTGAACATCTTCAGATATTCACTGAAGAAGAA TTAGAGCATTTACTATGTGGAGAACGCGATTCTTGGGCTTTCAATGAGCTCCTTGATCAT ATCAAGTTCGACCATGGCTACACTGTTAGCAGTCCTCCCATTGTTAATTTGCTGGAAGTC ATACACAAGTTTGACCAAGAACAGCGAAGAGCGTTTCTGCAGTTTGTGACTGGGGCACCT CGCCTACCTCCAGGAGGTTTTGCATCTCTCAGTCCGAAGTTAACTATTGTTCGAAAGCAT TCTAGCAACTGTGCTGACTTGGACCTACCAAGTGTGATGACTTGTGCAAATTATCTTAAG CTGCCACCTTACTCTTCAAAAGAGAGGATGAAAGATAAGCTCTTATATGCCATTACAGAA GGGCAAGGATCATTCCACCTTTCATAG
PEP MASRGQKRTEVDDELPADKRACSSLEFRPSSSNSSAQTHMNSMNSTPETNDHDMDTTSSA SASSRSEGEHEKDSAYGSCDSDDADPRHSELRDYQRRRSSGDHGKFKRILSSLSEETDPS GQLAVLTELCEVLSFCTEDSLSGMTSDSLSPLLVRLARHETNPDIMLLAIRAITYLCDVH PRSSAFLVRHDAVPALCQRLMAIEYLDVAEQCLQALEKMSREQPLACLQAGAIMAVLNYI DFFSTSIQRVALSTVVNICKKLPSECPSPFMEAVPILCNLLQYEDPQLVENVAVCLIKIT ERVSQSTEMLDQLCKHGLIRQVTHFMNLNNRATLSQPICNVGIQHHVPEIRLFCILLPWI VAFRTLYELNISSTLKDILSTYELSHGMSSSHVVDGHCNQVYEVLKLLNELLPTSAGDQD DPQLSDKESFLVNQPDLLQKFGMDILPLLIQVVNSGANLYICYGCLSVINKLIYLSTSDM LVELLQNANISSFLAGVFTRKDPHVLILALRITELILQKLSDYFLDSFIKEGVFFAIDAL STPEKCQLVTLEKCSRLVFPVFSGTQPLFDPSQKSASREVLRCLCYAFATGKSPSVSETG SCMLEKDSVYNLAKHIRTTYFAPELYDSGKALTDVLQKLRKFSAALSDLNTSMNNDALDQ HEERFYGIMRQVMEKLGGGEPISTFEFIESGILKSLMTYLSNSQYLRQKGELSAVNTDIY SVEKRFEVFARLLFSPSDLLSADVPIITLIRKLQNALSSLENFPVILSHIPKLRSSYAAV PYGRRTTYTCIRVRFVKDKGDTYLCDYSEDVLTVDPFSSLHAIQEFLWPKVNAKRTNHIK SATRVKGQSESPPLQSPSNASSSQGGSPHPMDPESMSMDLPELQETVEKLVQCPSDEDTE MEEQCPASCSNEDSSSKLLLYLDGQQLEPALTLYQAILQQQMKEHEIVIGAKLWSQVYTL TYRKAEGQDGTRKECLYSAESSAVSDKVGVYELYTSFFSSMFSCELASDLEKSSPTYDII YLLKSLQSMNKFIFYLMSHERICAFAEGKINDLDNFQMSVIPVPQNEFVSNKLTEKLEQQ MRDALAVSIGGMPLWCNQLMTSCPFLFSFEVKCKYFRLAAFGPLLVQPHSPSYRDSGVAS DRRLSSGGMPRKKFLVFRNQILDSAAQMMDLHASQKVLLEVEYNEEVGTGLGPTLEFYTL VSHEFQKSGLGMWREDHGSFISGTTHAEDTGILICPFGLFPRPWSSTLDTSDGIQFSEVI KKFVLLGQIVGKALQDGRVLDLHFSKAFYKLILGQELGLYDIQSFDPELGRTLLEFKALI DRKKFMESVHGGATFEFDSCFRKTKIEDLCLDFTLPGYPDFVLSSRPDNKMVNITNLEDY VSYVADATVKAGITRQLEAFKSGFNQVFPIEHLQIFTEEELEHLLCGERDSWAFNELLDH IKFDHGYTVSSPPIVNLLEVIHKFDQEQRRAFLQFVTGAPRLPPGGFASLSPKLTIVRKH SSNCADLDLPSVMTCANYLKLPPYSSKERMKDKLLYAITEGQGSFHLS


| Top |