Cherry SNP DataBase

Gene information

Gene Pav_sc0000659.1_g360.1.mk
Chromosome name PAV_r1.0chr6
start 1199338
end 1202400
PAV_r1.0 name Pav_sc0000659.1
start 256028
end 259090
direction +
Annotation NR PREDICTED: uncharacterized protein LOC101312235 isoform X1
Sequence CDS ATGGCCACCGTTTCCCCGCCTGTGGATCAAGCTGCAGATTTGCTGCAGAATTTGTCATTA GATTCTCAGACCAAAGGACCTGATGATATTCCTGACCCTGCCAAGAAGCCTATGGTGGGA CTGGAAATGAGTGGGGCGGCATTTCAAAAGCTGACCCCTAACAGTAAAACACACACCCCT AATTCAGCTGTTCCTTTCAAGGGGGGTGTTTCCACCTCTAAAGATGCTGGCCACAAGCCC TCAACTGTAGGAATAGCTAAAGGTATTTCTAATGGTGTTCTGACCAGTGTGGGTATGAAG GAATATAATCCTTCAGATTTCGCAAAACCAACTTATCAAAACTCATCACTGAATGTAAAG GGTTCCTTCAGTGAATACCATGATGCAATATATGGTTTTGATGGTTTGGTATCTCCTATC CCATGGTTAGAAGGGGCAAATGGGCAGGGTAGGGCAGTGACTGGAAGTATAGTCAACAGA ACTCCATATTCCAAGAATCAGATTTCCAGATCAAATTCTGAATTCATGTATAAATACAGG GGGCGAGGCAGTTCCTTCCGCTATGGTAACCAGGACATAGAAGGCTTGGATGAGTTGAAC AAGGGACCTAGAGGTAAAAGTTATAAAAATCAAAAAGGATATTCACCTGTTACTGTAGCA GTTAAGGGGTGCAACATGCCGTTGAATAAAACTGATGATGAGAAGGATGCACTTAGCATG ATTCCAGAGTGTGAGCAGTACATTGGAGCAGATATCCATGATCATTATGCTGATGCTAAG TTCTTCATTATTAAGTCATATAGTGAGGATGATGTTCATAAGAGTGTCAAGTATAATGTT TGGGCCAGCACACCAAATGGAAACAATAAGCTTAATGCAGCATACCAGGAGGCTCAGGAA AAATCAGGTGGCTGCCCTGTATTTCTGTTCTTCTCG
PEP MATVSPPVDQAADLLQNLSLDSQTKGPDDIPDPAKKPMVGLEMSGAAFQKLTPNSKTHTP NSAVPFKGGVSTSKDAGHKPSTVGIAKGISNGVLTSVGMKEYNPSDFAKPTYQNSSLNVK GSFSEYHDAIYGFDGLVSPIPWLEGANGQGRAVTGSIVNRTPYSKNQISRSNSEFMYKYR GRGSSFRYGNQDIEGLDELNKGPRGKSYKNQKGYSPVTVAVKGCNMPLNKTDDEKDALSM IPECEQYIGADIHDHYADAKFFIIKSYSEDDVHKSVKYNVWASTPNGNNKLNAAYQEAQE KSGGCPVFLFFS


| Top |