Cherry SNP DataBase

Gene information

Gene Pav_sc0000661.1_g150.1.mk
Chromosome name PAV_r1.0chr3
start 18278889
end 18280208
PAV_r1.0 name Pav_sc0000661.1
start 88215
end 89534
direction +
Annotation NR PREDICTED: F-box/kelch-repeat protein At5g15710
Sequence CDS ATGGATGGTGCTGGGAAATCTTCTGAATCTGGGTCTGCAGCGTCAAGTCTGAAATCTATG GAAAATGGGTGTTCTGGTAAAGATGTTGGGTGCCTAAAGCAAGTGTCACCTCTTAGAGGT GGTGGGTCGAGGAATACGAGTCCTTTGGGTTGTGTAAGATCAAGAAACACTAGCCCTTCG AGGCAGAAGGTGGTTAAGACAAAACCGCGAGGGCTAGATGAGGAAACGGCTTCTACTTTT GGTAAAGCAATTCATCCTGATGTTCAAATGGAGGATAATATATGGGCAATGTTGCCAGAG GACTTGTTGAATGAGATATTAGCTAGGGTTCCGCCATTTATGATATTTAGGCTCCGGTGT GTTTGTAAACGGTGGAATACAATTCTACAAGATAGAAGTTTTCTTAAGTTCCACTCGCAA GTGCCGTCTCATGGGCCTTGTCTTCTCACATTCTGGAAGAACTCTCAGACCCCACAATGC TCAGTCTTCAGCTTACCATTAAAAACATGGTACAGAATTCCGTTCACATTTTTGCCACAG TGGGCATTCTGGTTGGTGGGCTCTTCTGCTGGTCTAGTTTGCTTTTCTGGGCTTGATGGC TTAAGTTTTAAAACCTTGGTTTGTAACCCTCTTACACAAACTTGGAGGACATTGCCAAGT ATGCATTATAATCAGCAAAGGCAGCTGATAATGGTTGTTGATAAGAAGGACCGGTCATTT AAAATTATAGCCACTAGTGATATTTATGGTGACAATAAGTCGTTGCCCACTGAAGTATAT GATTCAAAGCTAAATAGTTGGTCAATTCACCAGATAATGCCTGCAGTTAATCTTTGCTCC TCCAAGATGGCATATTGCGACTCCAGACTATATTTGGAAACCCTTTCTCCACTTGGCCTA ATGATGTACCGGTTGGACACAGGATACTGGGAACACATTCCAGCTAGGTTCCCACGGTCT CTATTGGATGGTTATTTGGTAGCTGGCACCCAGAAGCGTTTGTTTCTAGTTGGAAGGATT GGTCTTTATAGTACTCTTCAGAGTATGAGAATATGGGAATTGGATCATACAAAATTTATA TGGGTGGAGATTAGCAGGATGCCTCCAAAGTATTTTCGATCTTTGTTAAGGTTATCAGCT GAGAGATTCGAGTGCTCTGGACAGGATAACTTGATTTGCTTCACATCTTGGAACCAGGGG AAGGGCCTTCTCTATGACGTGGATAAGAAGGTGTGGTCCTGGATTGCAGGCTGTGCTCTT CAGTCGTACAACAGCCAGGTTTGTTTCTATGAGCCGAGATTTGATGCTTCCATCTACTGA
PEP MDGAGKSSESGSAASSLKSMENGCSGKDVGCLKQVSPLRGGGSRNTSPLGCVRSRNTSPS RQKVVKTKPRGLDEETASTFGKAIHPDVQMEDNIWAMLPEDLLNEILARVPPFMIFRLRC VCKRWNTILQDRSFLKFHSQVPSHGPCLLTFWKNSQTPQCSVFSLPLKTWYRIPFTFLPQ WAFWLVGSSAGLVCFSGLDGLSFKTLVCNPLTQTWRTLPSMHYNQQRQLIMVVDKKDRSF KIIATSDIYGDNKSLPTEVYDSKLNSWSIHQIMPAVNLCSSKMAYCDSRLYLETLSPLGL MMYRLDTGYWEHIPARFPRSLLDGYLVAGTQKRLFLVGRIGLYSTLQSMRIWELDHTKFI WVEISRMPPKYFRSLLRLSAERFECSGQDNLICFTSWNQGKGLLYDVDKKVWSWIAGCAL QSYNSQVCFYEPRFDASIY


| Top |