Cherry SNP DataBase

Gene information

Gene Pav_sc0000667.1_g040.1.mk
Chromosome name PAV_r1.0chr7
start 9106900
end 9118864
PAV_r1.0 name Pav_sc0000667.1
start 15999
end 27963
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103341867
Sequence CDS ATGCACTGCAAGATTAGTACATGTCCACCGCATTCTATTAGTTGCTCTGGGGACATTCGC ATTGTTATGCGTCTTCATGCTCACGCCCACACAGGCCCCAAAAATCCAACTCGACTCACT CTTCAAAACCCCAATGTGGTCTCTTGGGTTCAATTCGACCGCATAGAGGGTTCAATTCTG TACAAGGACAACTCTCTCGCGATATACTCTGTCGAGCCATTTGACTTGGGATTGAAGGAA CAAAGATTGCTGCGTGTGAAGATATCGAGGACCGGATTACAGGATCAGCAGGCGATGAAG GTGTCGGATTTGGAAGAAATGAATAGGCAACGTGAAGATGGTGCTGTGAGTTTGAAGATG GAAATGTTTGCATGGGCTACATATAAGAAGGGTTGGTGGGGAACAGAAGTTGTCATCATG GAGGCTCACTGTTTGGATTTGAGGGTTGGTTTCTTGCCTAAAGTTGAGTTCGGTAGCTGG ATCAGTGGAGGGCCGATGACTTGCTCGACTGGGATCGTCACGTTGCTATGCGTAGCCATG GCCACATCCCTAGTTCCACAGCCCCCGAAAATCAAACTCAACTCTCTCTTCATGTTGAAA ATTAACGTCTCAAACACAAAGCTAGGGGCCAACTTTGACGTGGCCTTCACAATAGAGAAC CCTAATCTAGTCTCGTGGATTCACTTTGACCGCATAGATGGTTCGATTTCTTACAAAGAT AACGCTCTCATGACATACTCGTTGGACCCTTTCGTACTGGGATTGAAGGAACATAGAATG ATGCGAGTGAAGATATCCGCGAATGGATTACAGGAAGATCAGCCGGTTGTGAAGGAGAGG GTTTTGGAAGAAATCCATAGGCAACGTGAAGATGGTGCTGTGAATTTCAGCCTGGAAATG TTTGCACGGGCTACGTATAGGACCGGTTGGTGGGGGACAAAGTCTGTTTTAATGAACCCT CAATGTTTGGATTTGAGGGTTGGCTTCTTGCCTAAAGTTGGGTTCGGAAGCTGGATTACC ATGGAAATCAATGCAAAAGCTAATCAGCACTCAGCCACCATGCCTCTGCTTCCAGTTTCA TATAGCCCTTCAAACGACAACGTTTCGCAGTCTCTTAAATCACGACGCATGTCCAAATCA TCCCTCTTCCAACCCATTATTCTATTATCACCTACATTATTAATATTTGGGACCTTGGCA TTGCTATGCATTTTCATGTCCTTGTTGTCCCAAGTTCATCCACAAGCCCCAAATGTCCAA CTCAACTCGCTCTTCATGTCCAAATTTAACATCTCCAACACAACATTGGGGGCTAATTGG GACATGACCCTTACAATAGACAACCCCAACCTGGTCACATGGGTTCGTTTCAACCACATC AAGGGTTCAATTTCGTACAAAGATAACATCCTCGCGATAAGCTCCGTCGAGCCATTCGTG TTGGGATTGAAGGAACGAAGAACAGTGCGCGTGAAGATATCGACTTTGGGGTTGAGGGAA GAGGATCGTGATCATCAGCTGGTGGTGAAGAAGAGGGTTTTGGATGAAATGATGAGCAGG AGACGTGAGGATGGAGCTGTGCATTTTAGCATGCAAATGTTTGTTTGGGCTACGTATAGG ACTGGTTGGTGGGGAACACAAGATGTTGTGATGAGCCCTCAGTGTTTGGATTTGAAGGCT GGGTTCTTGCGTGGAATTGGGTTCGGGAGTTGGATTAGTGGAGGGCCTATGATGTGCTCG GAAGAGTTATGCATGGCTTCTTTGTGGTGCAAAAAGTCTCCAGATTGCAGTAAAATTCGT GGATACATCTTGCTTTCTGTGATAGTGGTGAGTCTAGCAACAGCCATCGGATTTTCTCTC TGGTTCTTAGGCAACTATGTGGATTCAAAGTCCGGCCCAGGAACAGACCCCCTTGTGCTT CGTTTGGATGCATTTTCTTTATCGAATTTCGAGGTTTCAAATTCGTCATTCTCAGCTGAA TGGGAGGCCAAGTTGACATTTGGGAACCAAAACGGTGGCCTAACTGTTACCCTCAACCCC TTTGAGAGTTATGTGTACTATAAAGAACGTGAGGCTCTATCATGTGCTTCTGTGGATGCA ATGCTGCATGTTCCTCCAAGGAAACAGAAAACTCTGCAGATCAAATTTGATCCGACAAGT TGCAGAGGAGAACAGCCGTATGTGGAGGATCGAGTGATGAAGGAGTTGAGTGAAGATCGA AAGAGTGGTCACCTTAGCTTTAGTTTGAAAATGCGCATAGATGCTTCTTATAGTATGAGG GAGCTTTTGGGAATGGGAACCCAAGTGACTTTAAATCCTAACTGTTCAGGGTTGAAGGTT CAGTTTGAGGGTGCAAAAGGGGAGGGAAAGATAAATGGGGGCCGCAAAAAAACAAAAATG GGCCCTTTGCGGTCTCGTCGCCATAAGGCACTGGCAGAAGAAATGTACTTGAAATTGGCC GCTGCCACAATCCTCATCACATTACTTGCATTTGTCACCACCGTATGTTTGTCGTTGAAC GGCGGCATTCGAACATATCCCATCGCCATTGCTCAGCACTCTTTCTCTGTCTCAAACACA ACGAAACCCGTCTCTGAAATGCAGAGCGCTGTTTGGGATGCAGAGTTGAAGTTCAGCCAA AACAGTGATCTGCAAGTTCACATCAAACACTTTCAGGGCTACGTGTACTACCCGAAATTC GAACCGCTGTGGTGTGCCTCAGTGAAGCCAGTGGACGTTGAGTTCAGGAGTCCAAATGGG CTGTTCATAAGATTTGATATGAGTGAGTGTGGGGAGGAAGGGCTCGGGGTTTCGACAGAG GAAGCTCTGAAGGAGGTTCGTTTGGAAATGAAAATGGACCTGGTTGTGCCTTACCAGTTT GGAAAGACCAGAATTTGGGCCTGGCTTTGGGGATTGAGTGTTGAAGAATCTTGTTCTGAG TTGAGAGTTGAGTTTGTGTCTTCGATTGGAGAGGGGAAGCTGATTGGTGAGGGAGGATGG TGCTTTGTTCCATTGCCTGAG
PEP MHCKISTCPPHSISCSGDIRIVMRLHAHAHTGPKNPTRLTLQNPNVVSWVQFDRIEGSIL YKDNSLAIYSVEPFDLGLKEQRLLRVKISRTGLQDQQAMKVSDLEEMNRQREDGAVSLKM EMFAWATYKKGWWGTEVVIMEAHCLDLRVGFLPKVEFGSWISGGPMTCSTGIVTLLCVAM ATSLVPQPPKIKLNSLFMLKINVSNTKLGANFDVAFTIENPNLVSWIHFDRIDGSISYKD NALMTYSLDPFVLGLKEHRMMRVKISANGLQEDQPVVKERVLEEIHRQREDGAVNFSLEM FARATYRTGWWGTKSVLMNPQCLDLRVGFLPKVGFGSWITMEINAKANQHSATMPLLPVS YSPSNDNVSQSLKSRRMSKSSLFQPIILLSPTLLIFGTLALLCIFMSLLSQVHPQAPNVQ LNSLFMSKFNISNTTLGANWDMTLTIDNPNLVTWVRFNHIKGSISYKDNILAISSVEPFV LGLKERRTVRVKISTLGLREEDRDHQLVVKKRVLDEMMSRRREDGAVHFSMQMFVWATYR TGWWGTQDVVMSPQCLDLKAGFLRGIGFGSWISGGPMMCSEELCMASLWCKKSPDCSKIR GYILLSVIVVSLATAIGFSLWFLGNYVDSKSGPGTDPLVLRLDAFSLSNFEVSNSSFSAE WEAKLTFGNQNGGLTVTLNPFESYVYYKEREALSCASVDAMLHVPPRKQKTLQIKFDPTS CRGEQPYVEDRVMKELSEDRKSGHLSFSLKMRIDASYSMRELLGMGTQVTLNPNCSGLKV QFEGAKGEGKINGGRKKTKMGPLRSRRHKALAEEMYLKLAAATILITLLAFVTTVCLSLN GGIRTYPIAIAQHSFSVSNTTKPVSEMQSAVWDAELKFSQNSDLQVHIKHFQGYVYYPKF EPLWCASVKPVDVEFRSPNGLFIRFDMSECGEEGLGVSTEEALKEVRLEMKMDLVVPYQF GKTRIWAWLWGLSVEESCSELRVEFVSSIGEGKLIGEGGWCFVPLPE


| Top |