Cherry SNP DataBase

Gene information

Gene Pav_sc0000670.1_g010.1.br
Chromosome name PAV_r1.0chr8
start 5439494
end 5439975
PAV_r1.0 name Pav_sc0000670.1
start 1
end 482
direction -
Annotation NR PREDICTED: receptor-like protein 12
Sequence CDS ATGAAAACTTTGCTGCATTACTTGTTCGTCCTCTGCTTCAATATCCTCCCTGCAGTTCAC AGCCAGTGTATTAAAGACCAGCAACAATCGTTGCTCCATTTGAAGGAAAGCATTCTATCT TATTCATTTGAAGTACAGCAAACTTGGAATTCAAGCACCAACTGTTGTTCTTGGGTTGGT GTTAATTGCACTAGCAATGGGCATGTTGTTGGTCTTGACCTTAGCTTCAAATTTATCTAC TATCTAATTCCAGGATCCTTTGCCAACTTTCCAAACTTGAGGGAGTTGGACTTGAGAGGA AACTACATCTCTTATATTCCAGAATCCTTTGCCAACATTTCAAACCTGAGGGTGTTGGAC TTGAGTGGGAACGACATCTCCGGTCCAATTCTAGGTTCCTTTGCCAACTTTTCAAACCTG AGGGTGTTGAACTTGAGGGCGAACGACATCTCCGGTCCAATTCCAGGATCCTTTGCCAAC TT
PEP MKTLLHYLFVLCFNILPAVHSQCIKDQQQSLLHLKESILSYSFEVQQTWNSSTNCCSWVG VNCTSNGHVVGLDLSFKFIYYLIPGSFANFPNLRELDLRGNYISYIPESFANISNLRVLD LSGNDISGPILGSFANFSNLRVLNLRANDISGPIPGSFAN


| Top |