Cherry SNP DataBase

Gene information

Gene Pav_sc0000691.1_g200.1.mk
Chromosome name PAV_r1.0chr1
start 37131416
end 37136863
PAV_r1.0 name Pav_sc0000691.1
start 114797
end 120244
direction -
Annotation NR PREDICTED: TPR repeat-containing thioredoxin TTL1
Sequence CDS ATGGCAGAGATGGCAAAGTATAAGGTGGACAAGGATTTGGGTTGTGGTTTTATGGGTGTG ATTTTCCAGTGCAGAAGCTACTGGTCTAGAAAATCCTCTGTTCATTCACTACCTTCAAAC AGTAGCAAAAATGATTTGAAAGCACCAATCAATGATGATTATTCTACAAAGTCTGAAGAA TCCAAGAGCCAACAACCCAAATCCACAGAGGCCGCTATTGTAGTCTCCTCCAATACGGGT AGACCTTCTCCGAATCGAGACTCGAAACATGCCAGGAAGCCTAGCTTGGGTCATCCAAGG CCTTCAGCTTGTCACCAGAAGGTTCAACCGAGAAGGCATTCAGATGCTGGAAGAAGGTCA ACATCTTCATCCAATGGACAGTTGGGGAACTTGAGGCAGCCGGCAAGCAACAGTCCCACA GCCACAATCAAGACTCTGACTTATCATCTTAGAAATCTTGAAGACTCGAATTCGACATTT ACCCGAAAAAATGGATTTGGAAAACTAGGAGGCAATGTTGTGATGGGTAACATTGTGAGG AAGAACAGTGATGAGTTTGGAGGTCTTTCCCGGAACAAGTTAGACCCTGAGGTGTTAAAG TCCATGGGAAATGAGGCATACAAACAGGGCAGATTTGAAGAGGCCTTGGCTTTTTATGAC CGAGCAATTGCTTTGGATTCAAATAAGGCTGCTTATCACAGCAATAAAGGAGCAGCTTTG ATTGGTTTAGGCCGTCTTATCGAGGCGGTTTTCCAATGCAAAGAAGCAATCCAGATTGAG CCTTCTTATCACAAAGCTCATCATCGGTTGGCAACAACTTATCTCAGATTGGGAGAAGCA GAGAAAGCATTGGATCACTACAAACACTCGGGTCCATACGCTAACTCAAAAGAGGTTGAC CAATGTCAGGCCCTTCAAAAATGCCTCAGCAGATGCACTGAAGCTCAGAAATTACAAGAG TGGAATATTTTGCTGAACGAGACCCAACTGGCAATTTCCTCAGGTGCCAATTCAGCTCCA CAGGTCTTTGCTCTACAAGCTGAGGCCTTGCTGAAGCTTCACAGACATCAAGAGGCCTAT GCCACCTACCAAAAACGACCCAGTTTCAGCATTGATATATGCACCAAGTTCTTTGGCTTA GCAAGTAGTGCTTATCTGTTAATGATTGGGGCTCAGGTTTACTTGGCTGCTGGCAGACAT CAAGAGGCCTATGCCACCTACCAAAAACGACCCAGTTTCAGCATTGATATATGCACCAAG TTCTTTGGATTGGCAAGTAGTGCTTATCTGTTAATGATTGGGGCTCAGGTTTACTTGGCT GTTGGCAGGTTTGAAGATGCTATAGCTGCAGTTCAGAATGCAGCACGACTCAATCCAAGT GACAAGAATGTCGCTGCGGTGGTGAAGAGGGCTCGCGCTGTTGCATCAGCCCGAGTGGAG GTGGAAGACCATCCATACTTGGCCAAAATGGAGGATGTGAGCACAATCCCAGCCTTCAAG ATATACAAAAATGGATCAAGGGTGGAGGTGGAAGACCATCCATACTTGGCCAAAATGGAG GATGTGAGCACAATCCCAGCCTTCAAGATATACAAAAATGGATCAAGGGTCAAAGAAATT CCAGGCAGCAACCATGAATTATTAGAAAGCTCAGTCAAATTGTACAGCAGTTGA
PEP MAEMAKYKVDKDLGCGFMGVIFQCRSYWSRKSSVHSLPSNSSKNDLKAPINDDYSTKSEE SKSQQPKSTEAAIVVSSNTGRPSPNRDSKHARKPSLGHPRPSACHQKVQPRRHSDAGRRS TSSSNGQLGNLRQPASNSPTATIKTLTYHLRNLEDSNSTFTRKNGFGKLGGNVVMGNIVR KNSDEFGGLSRNKLDPEVLKSMGNEAYKQGRFEEALAFYDRAIALDSNKAAYHSNKGAAL IGLGRLIEAVFQCKEAIQIEPSYHKAHHRLATTYLRLGEAEKALDHYKHSGPYANSKEVD QCQALQKCLSRCTEAQKLQEWNILLNETQLAISSGANSAPQVFALQAEALLKLHRHQEAY ATYQKRPSFSIDICTKFFGLASSAYLLMIGAQVYLAAGRHQEAYATYQKRPSFSIDICTK FFGLASSAYLLMIGAQVYLAVGRFEDAIAAVQNAARLNPSDKNVAAVVKRARAVASARVE VEDHPYLAKMEDVSTIPAFKIYKNGSRVEVEDHPYLAKMEDVSTIPAFKIYKNGSRVKEI PGSNHELLESSVKLYSS


| Top |