Cherry SNP DataBase

Gene information

Gene Pav_sc0000691.1_g550.1.mk
Chromosome name PAV_r1.0chr1
start 37318498
end 37327010
PAV_r1.0 name Pav_sc0000691.1
start 301879
end 310391
direction +
Annotation NR hypothetical protein PRUPE_ppa004853mg
Sequence CDS ATGTTTGGCGATGGAAGCAAAGCTGCCAAATCCGCCATTTTCACCAACCCTTCTTCTTCC CATTCGCATTCCAATCCCTCGAACTCTCCAACCTCACAATCCAAACACACTCTGACGAAG ACGATGACAGCCACAGCCCACAAAACCCAAAACCTATTCAATCCCATTCCCACGCATAAA ATGGACGACCCAAATTCGAGCCTTTTCATCACCGGCGGCTTGTTTTTGGAACCCACAATT TCCAATTCTCTGCTCAATTCCGTGGTGTCGTTCCGGAAGTCTGTCGTTTCCGCGTCTGGT TCGTCGTATGGGTTTAGGCTGAGAGCGGTGGCTGGAGGTGGGTTCTTGTCGGTGAGCTTG AAAAGCGATGGGGTTGTACGGGAATCCAAAGGGTGTTTGCTGCAGAACGGAGATGAGGAT TCGGAGGAGGCGGTGGTTGAAGAGATGAAGACAGAGAAAGTTGGGATTAGGGGAGGTAGA GCTATGAACACCACCAAGCATTTGTGGGCTGGTGCTATAGCCGCCATGGTTTCCAGAACT TTTGTTGCACCTCTTGAGAGACTAAAGCTGGAATATATAGTTCGTGGAGAACAGAGGCAT CTATTCGAGCTGGTTAAGTCAATTGCGGTTTCTCAGGGCTTGAGGGGCTTTTGGAAGGGG AACTTAGTCAATATTCTTCGTACAGCTCCATTTAAAGCAATCAATTTCTATGCTTATGAT ACTTACAGAAAACAATTGCTCCGCTTCTCCGGAAATAAGGAGACTACAAATTTTGAGAGG TTTGTTGCCGGTGCTGCAGCTGGAATTACTGCTACCATACTCTGCTTACCTCTTGACACG ATTCGGACTAAGTTGGTGGCTCCTGGTGGGGAAGTCTTAGGTGGTGTAATTGGTGCTTTC CGCCACATGATCCAAACTGAAGGGTTCTTTTCACTTTATAAGGGCCTGGTACCCTCCATC GCAAGCATGGCACCTTCAGGTGCAGTTTTCTATGGTGTCTATGATATATTAAAATCAGCT TATCTGCATTCACCAGATGGAAGGAAAAGAATTCAAAAGATGAGCCAACAGGGGCTGGGC CTGAATGCTTTCGACCAACTGGAGCTGGGACCCGTTAGGACATTACTTTATGGAGCTATT GCTGGTGCTTGTGCAGAAGCTGCCACATATCCGTTTGAAGTGGTGAGGAGACAGCTGCAA TTGCAAGTCCAGGCAACTAAAATGAGTGCCTTGGCAACTTGTATGAAAATAGTGGAACAT GGAGGTGTCCCAGCTCTTTATGCAGGACTTGTTCCCAGCTTGTTACAGGCATTTAGCACT GAGGAATTGCAAAAGAAATTGTGGTGCTGCCATAGTGCTTTTGGGCATAAAGCCTCTACG CACACTCCTCTCATCCGCTTCGAATATTCTTCGTATTCTTCACAAAAAACGCCATTCCTG CAAACCCCGAATCTGTTCCGCACCATGTCGCCGTCCGGCGACCTCTGCACATGCTTCGCC GGCGAAAATGGCCGTCCCAACGGCGACCACCACGAATCCGCCGATCCGAATTGTACGCAT TGCAAGAAATCCGATCCGTCGCCGTCGTCGTTTTACTATTCTTCTTCGCTCGGATACGTT TCGGTGCCGTTGAGCGACTCGGAAAAGCTACGGCGGGTCGTAACTGCCTCAATCAAGGGC TTCACCATCGGAGCCGGTCTCAAAGGCGGGCTCGCCATTTTCTCCATCTTAGCTCGATTG AGACGACGAAAGCTCTTAGCCTCTCTCAGGAAGGAGGGTGTGATTACAAATAATGAAGCT ATTGTTACTGCTTTGAAAGAGACATTGAGATATGGTCTATTTCTTGGAACTTTTGCTGGT ACATTTGTTTCAGTGGATGAGATTATAGGTTCTTTGGCTGGTCACCGTAGGCAATTCAGG ACAGCCAAATGGAGGGCTTTGTTAGCAGGAGCTGTAGCTGGGCCATCGATGCTTCTCACT GGCCTGAACACGCAGCATACGAGCTTGGCCATATACATACTTATGCGTGCTGCTGTGTTG GCGTCGCGGTGTGGGATTAAAAGCAAACGTTTCGGGGGCATTTGTAAACCTCTCACTTGG GCTCATGGTGACATTTTTCTTATGTGTCTCTCCTCTTCGCAAATTCTGTCTGCTTACATA TTGAAGCAGGAAAGTTTACCTCCATCATACAAATCTTTTCTCAATAAACATGGTGGAAAG GATACAGTAATATTGCAAGGTGTAAAAGAGATTGCAAGTGGCATACCTTTTTCTAATTTG GAAGCAATAGAAAAATATTACAAATCCATTGGAACAAATATTAAACTAGATCCAGCCATG GAAGTTCCCTGCTCGATTGTACATGGAGATCAGTCGTGTAGTGCGCATATTATTTCTTTC CTAGTTCAAGCCTATAAGAGAGCATTACCAGTTTATCTTCCAGTGTATCTGATTCCCGCC CTTATAGTTCATCGCCAAGATCTCCTGAAAAGGCATTACTCTATACTACTAAAGGGCCTT CTTGGTACTGCAAGATCAAGCTTGTTTCTATCCGTATATTGCTCATCTGCCTGGGCATGG ACATGCTTTCTATTTAGGATTTTCAGGAGATGTAATATTCCAATGGTAGCGATGGGGACG TTCCCAACTGGCTTGGCCTTGGCCATTGAGAAGAAAAGCAGGCGAATTGAGATTTCCCTC TACTGTCTTGCTCGGGCCATCGAGAGCTTTTTCACGTGCATGGCTGATACCGGATACTTG CCACCATCAACGAAAATGAAGAGAGCTGATGTTGTAATCTTCAGCTTATCCACGGCAATC ATAATGCATTGCTATGCACAGGAGAGGGAAGTGTTCCGATCCAAATACTTGAATGTCCTT GATTGGGTTTTTGGGGTTCCACCTCCTTCTTGTGAAACCCCTCGCTGCAAAAAGAGTTGG GAATAA
PEP MFGDGSKAAKSAIFTNPSSSHSHSNPSNSPTSQSKHTLTKTMTATAHKTQNLFNPIPTHK MDDPNSSLFITGGLFLEPTISNSLLNSVVSFRKSVVSASGSSYGFRLRAVAGGGFLSVSL KSDGVVRESKGCLLQNGDEDSEEAVVEEMKTEKVGIRGGRAMNTTKHLWAGAIAAMVSRT FVAPLERLKLEYIVRGEQRHLFELVKSIAVSQGLRGFWKGNLVNILRTAPFKAINFYAYD TYRKQLLRFSGNKETTNFERFVAGAAAGITATILCLPLDTIRTKLVAPGGEVLGGVIGAF RHMIQTEGFFSLYKGLVPSIASMAPSGAVFYGVYDILKSAYLHSPDGRKRIQKMSQQGLG LNAFDQLELGPVRTLLYGAIAGACAEAATYPFEVVRRQLQLQVQATKMSALATCMKIVEH GGVPALYAGLVPSLLQAFSTEELQKKLWCCHSAFGHKASTHTPLIRFEYSSYSSQKTPFL QTPNLFRTMSPSGDLCTCFAGENGRPNGDHHESADPNCTHCKKSDPSPSSFYYSSSLGYV SVPLSDSEKLRRVVTASIKGFTIGAGLKGGLAIFSILARLRRRKLLASLRKEGVITNNEA IVTALKETLRYGLFLGTFAGTFVSVDEIIGSLAGHRRQFRTAKWRALLAGAVAGPSMLLT GLNTQHTSLAIYILMRAAVLASRCGIKSKRFGGICKPLTWAHGDIFLMCLSSSQILSAYI LKQESLPPSYKSFLNKHGGKDTVILQGVKEIASGIPFSNLEAIEKYYKSIGTNIKLDPAM EVPCSIVHGDQSCSAHIISFLVQAYKRALPVYLPVYLIPALIVHRQDLLKRHYSILLKGL LGTARSSLFLSVYCSSAWAWTCFLFRIFRRCNIPMVAMGTFPTGLALAIEKKSRRIEISL YCLARAIESFFTCMADTGYLPPSTKMKRADVVIFSLSTAIIMHCYAQEREVFRSKYLNVL DWVFGVPPPSCETPRCKKSWE


| Top |