Cherry SNP DataBase

Gene information

Gene Pav_sc0000700.1_g1570.1.mk
Chromosome name PAV_r1.0chr6
start 23065894
end 23069158
PAV_r1.0 name Pav_sc0000700.1
start 830260
end 833524
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103318570
Sequence CDS ATGGCAACTGCTTCGCTGCTCCAACCCAACCCATTGAAATGGAAGCATAGCAGCTGCCCA TTTCTCTTGCCTCCTCTTCGTCCTCTGCCCACCAAGCCAATCAAATTCAGCTCAACCTTC GACGTTGAACAAGCTTCCTGTAATTTCAAGGTCAAATGCTTCAAGCACTCAACCGACTCA AAACCAGACCTTGATCACACTCAGTCTCTGTCCCCTGTTATCAAAGATAACCCAGCAAAC CCGCTTGAGCTTATCACCAGTAAACTATTAAATGCTCTCAAGGCGTTGAGAAAGCCGGCA ATGGCTGCCGTTTTATTGGGTCTGTTATTGATGTCCGACCCGAATTCGGCATTGGCCGCC TCGGGAGGGCGGGTCGGGGGGAGCTCGTTCTCGTCGCGGTCGTCTTCTTCGTCGTCGTCG TCGAGGAGCTACTCGGTGCCGAGGACTTCAAGTTCAAGACCCGATTTTTCGTACTCCGCG CCTTACTACGCGCCTTCGCCGTTCGGGTTCAGTGGGGGTGGTGGGGTTTACGTTGGGCCA GCATTTGGGTTCGGAGTGGGTGCCGGGTCGAGTTTCTTTCTGATCTTGACGGGTTTCGCT GCGTTTGTTTTGGTTTCGGGGTTCCTCTCGGATCGGTCCGAGGGTAGTGTGCTTACTGCT ACCGAGAAAACAAGTGTTCTCAAGCTTCAGGTTGGTTTGTTAGGCATGGGGCGAGCACTT CAAAGGGATCTTAATCGGATTGCTGAAACTGCAGATACTTCTACCTCTGAGGGTTTGGGA TATGTTTTGACAGAGACAACACTAGCTTTGCTTCGGCATCCTGATTATTGCATCTCAGGT TATTCATCTGTTGCTCAAAAGCGAGGCATAGAGGATGCAGAGAAACGCTTTAATCAGCTT TCTATTGAAGAAAGGGGTAAATTTGACGAAGAGACACTTGTCAATGTGAACAACATAAAA AGGCAAAGCTCATCAAGCCAGAGAGCTAATGGATTCCGCAACGAATATATAGTGATAACG ATTTTGGTGGCTGCTGAAGGAGTGCATAAGTTGCCCGCCATCAATGGTAGTGGTGACTTG AAGGAAGCGTTGCAAAAGCTTGGATCCATTCCCTCAAACAAAATATTAGCAGTAGAGGTG TTGTGGACTCCTCAGAATGAAACTGACACTCTGTCGGAGCGGGAACTACTTGAAGATTAC CCGCTTCTGAGGCCTTTATGA
PEP MATASLLQPNPLKWKHSSCPFLLPPLRPLPTKPIKFSSTFDVEQASCNFKVKCFKHSTDS KPDLDHTQSLSPVIKDNPANPLELITSKLLNALKALRKPAMAAVLLGLLLMSDPNSALAA SGGRVGGSSFSSRSSSSSSSSRSYSVPRTSSSRPDFSYSAPYYAPSPFGFSGGGGVYVGP AFGFGVGAGSSFFLILTGFAAFVLVSGFLSDRSEGSVLTATEKTSVLKLQVGLLGMGRAL QRDLNRIAETADTSTSEGLGYVLTETTLALLRHPDYCISGYSSVAQKRGIEDAEKRFNQL SIEERGKFDEETLVNVNNIKRQSSSSQRANGFRNEYIVITILVAAEGVHKLPAINGSGDL KEALQKLGSIPSNKILAVEVLWTPQNETDTLSERELLEDYPLLRPL


| Top |