Cherry SNP DataBase

Gene information

Gene Pav_sc0000700.1_g1750.1.mk
Chromosome name PAV_r1.0chr6
start 23134241
end 23141050
PAV_r1.0 name Pav_sc0000700.1
start 898607
end 905416
direction +
Annotation NR PREDICTED: multisubstrate pseudouridine synthase 7 isoform X1
Sequence CDS ATGTGGCTTAAGCCTGTACCATCGTGCTTCTCTATGCTAAAACCCTACTGCTCTGCCAGT CCACCACCACCAACCACCTTGAAATTCATAACGGCCATGAAAACTACAGAGGAACCAGAC GTCGGGATCTTCTGCTACATCTCTCAACTCCCTGGATTTCGCGGCATTTTAAAGCAAAGG TATTCTGATTTTATGGTAAATGAAGTAGATACAGAGGGAAATGTTGTTCATTTGACCAAC ATGGATGCCCCAGCAGAGACAGTTAAGGAAATTGAAACAAAGACACATGATGCTACAAGT AAAGATTATACTACCGAAATTGAATCGTTTAGATCTCTTGTTGACCCTGATGATGCTGAG CGATTGGAAGCTATAATCAATCAAATTAATTCCGGCAGTGAAGATAGTATTTTGCCTATT GTTCTTTCCCCAGATTATGATAAATCTCATCGAACGGTTAGTTTTTCATTTCATTTATGG CTTACATTATTAGTCTTTCAGGCAGTGCATAATTTTTTTAAGGAAAACTTCAAGTTCCTT GTCACCGACACAGTTGATGGACCAGATGCTTCATCAAAATGCATCCGGGTGAGAATAAAT TCAGGAGGACAGAACAGCAGAGGCAGAAATTCAAGAAAACGAAAAGAAAGAGGTGATAAA CCATTTGATAGCAGAGGTTCAGATGATTGGTCAGAAAATGTTGGCAAGTTCCTAAGGTCT TCTAATGTGAATGTACAGGTTTCATCTTTACAAGGAGAACAAGGATACACAGGAAGCCTT AGGAATTATAGGAAAGATGCTCGGTGTCCAGAGGAGTTGTTGCAGATTCTGAAGATACCA TCAAAGCATCTGCAATTGCCTTGGGAAAGCAGGGATTTATTAACTACTTTGGTTTACAAG TATGTACATAGTTACCAAAGCTATTTGTGGAACCATGCAGCAAGTATGAGAGTGCAGAAA TATGGAACTGACCGAGTTGTGTTGGGAGACTTGGTATATTGTAAAGGAAATGAAATTGAA AAGGTGTCAGAAGTTGTTAGTTCTGAATGTGTAGATGAAAATGGTAATGATACGCTTGAT CCTATTGACTTAGATGATATATCTGGAACAAATCTTCCTGAGGAAAGGCTTAATCTTGTG AAGGCTGTAACTGCGGAAGATATCCTTAGTGGAAATTACACCATTGATGATGTTGTCCTT CCAATGCCCGGTTCCAGAGTCATTTTTCCAGAAAACGATATCGCTGACGTTTTTCATGAT TTGGCAAAGAAGGATGCAATCAGCTTGACAGATAGCGTGCATAATGTCAAGGAATTCTCA ATAACCAGCATGACTGGAAGCTATAGGCGGGTCTTCCAAAAACCAATGGACTTTGAATGG GAAATACTAAAATATATTGATGCAAATAAACCTTTGGTGGACACAGACTTCGACAAAATT GCCAAAACCAAACCATCTAGTCTAAATGGAGATGGAAGATTGCATGATAAAACAAAACAA TCAGAGTGCTTGGACAACGATATAGGGCTTCAGACAGATGATAATGGGGCAAAGGCGAAG GGAGAAGAATTGCCACAAGCTGAATTCCTCTGTGATACTAATCCTCAGGAAACTCAGACG GCTCTCAAGTTGAGCTTTACTCTCCCAGCTTCTTGTTATGCAACAATGGCCATCAGAGAG CTACTGAAGACATCGACATCTGTATGTTGCGTTTCACAAAACGTTAAACTAGTGTGCGCC TTGATACTTGCGGTGAAGTATGGCATCCAAGATTGA
PEP MWLKPVPSCFSMLKPYCSASPPPPTTLKFITAMKTTEEPDVGIFCYISQLPGFRGILKQR YSDFMVNEVDTEGNVVHLTNMDAPAETVKEIETKTHDATSKDYTTEIESFRSLVDPDDAE RLEAIINQINSGSEDSILPIVLSPDYDKSHRTVSFSFHLWLTLLVFQAVHNFFKENFKFL VTDTVDGPDASSKCIRVRINSGGQNSRGRNSRKRKERGDKPFDSRGSDDWSENVGKFLRS SNVNVQVSSLQGEQGYTGSLRNYRKDARCPEELLQILKIPSKHLQLPWESRDLLTTLVYK YVHSYQSYLWNHAASMRVQKYGTDRVVLGDLVYCKGNEIEKVSEVVSSECVDENGNDTLD PIDLDDISGTNLPEERLNLVKAVTAEDILSGNYTIDDVVLPMPGSRVIFPENDIADVFHD LAKKDAISLTDSVHNVKEFSITSMTGSYRRVFQKPMDFEWEILKYIDANKPLVDTDFDKI AKTKPSSLNGDGRLHDKTKQSECLDNDIGLQTDDNGAKAKGEELPQAEFLCDTNPQETQT ALKLSFTLPASCYATMAIRELLKTSTSVCCVSQNVKLVCALILAVKYGIQD


| Top |