Cherry SNP DataBase

Gene information

Gene Pav_sc0000716.1_g210.1.br
Chromosome name PAV_r1.0chr3
start 5085132
end 5085926
PAV_r1.0 name Pav_sc0000716.1
start 125883
end 126677
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103441531
Sequence CDS ATGCCAATGGACCTCAATTTGGGTACTAAAGCTGATTTAGAAGATAATGATCAATACCAT GATTCAGAAAATGACTTGGGAAATGCGGAAATTGAGGACTCAGAATATGAAGAGGAAAAC AATACAACACAGCTAGATGAGTTGCTTTGTGAGAACATGCAATTTGAGGATATGCCACAT GTAAAGGTTGATAATGTGTTCCAAGATAATGTTGAATTCAATGACTTGCCTCGTGAAAAC ATTGGATGTGATGATGTTCCAATTATCAATGTGCACTCTGATGAACCCAACTCCAAAAAA CCAAATGCTCGGTACAAGGATAAAAACAATGTACATGGATCAAACATGACAGAGCTATGC AATGCAAGTGGAGATTTAATTGTAGGTCAAGTGTATGAGACTAAGGAGGATATAAAAACG AAGTTGGGTATTGATGCTATGACGAAAAATTATGAGTTCAAAGTGAAGAGATCCAATAAA GAAAGATTTGAAGTTGGTTGTGTCGATGACCGATGCATATGGAAATTGCGTGCATCCAAG GCAAGTAGTTCTCTTATTGGCCAATGCATAAAATCTAAGTACAAGAATGTATCACAAGTA CATAGACCCCACGACATCATTGAGGATATGCGAAAGGACATGGGTGTACGTATAAGCTAT GTGAAGGCTTGGAGAGATAGGGAACATGCACTAGAGTTGGTTAGGTGA
PEP MPMDLNLGTKADLEDNDQYHDSENDLGNAEIEDSEYEEENNTTQLDELLCENMQFEDMPH VKVDNVFQDNVEFNDLPRENIGCDDVPIINVHSDEPNSKKPNARYKDKNNVHGSNMTELC NASGDLIVGQVYETKEDIKTKLGIDAMTKNYEFKVKRSNKERFEVGCVDDRCIWKLRASK ASSSLIGQCIKSKYKNVSQVHRPHDIIEDMRKDMGVRISYVKAWRDREHALELVR


| Top |