Cherry SNP DataBase

Gene information

Gene Pav_sc0000716.1_g520.1.mk
Chromosome name PAV_r1.0chr3
start 5302962
end 5305442
PAV_r1.0 name Pav_sc0000716.1
start 343713
end 346193
direction -
Annotation NR PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic
Sequence CDS ATGACAGTCTGCAGCACTTCCTCTATCTCCACACAGAACCCAAACTCCGATTTGAACGAG CTTTGCCGCCATGGGAACCTTGAAAAAGCTCTGAAGCTCTTGGATTCAATGCAGGAGCTT CAAATTAAAGTGGAAGAAGATGCTTATATTGCTTTGGTTAGGCTGTGTGAGTGGAAGAGA ACACACGAGGAAGGAGCTCGTGTGTACTCTTATGTATCGAATTCCACGACCCTTTTGAGT GTTAAGCTTGGTAATGCCTTGTTGAGCATGTTTGTGAGGTTTGGTAATTTGGTTGATGCT TGGTATGTGTTTGGAAGAATGGGGGAGAGGGACGTGTTTTCTTGGAATGTTTTGGTTGGT GGGTATGCGAAAGCTGGGTTCTTTGATGAGGCTTTGAATTTGTATCACAGAATGTTGTGG GTTGGGATTGTGCCTGATGTGTATACATTTCCTTGTGTTCTTAGGACTTGTGGGGCCGTC CCGGACTTGGCGAGGGGAAGGGAGATTCATGTACACGTGATTAGATTTGGGTTTGAGTCG GATGTTGATGTGGTTAATGCTTTGATTACAATGTATGTAAAATGTAGTGCCGTTGGCAGT GCACGGATGTTGTTTGATAGAATGCCTAGGAGGGATAGGATCTCGTGGAATGCTATGATT TCGGGGTATTTTGAAAATGGAGAGTTTTTGGAAGGATTGAGATTGTTTCTCATGATGCTT GAATCTTCAGTTTATCCGGATTTGATGACTATGACTAGCTTGATATCTGCTTGTGAGCTT CTTGGTGACTGTGAGTTAGGGAGGGAAATCCATGGTTTTGTCATGAGAACAGAGTTTGCG GAGGATGTTTCAGTGTGTAATGCTTTAATTCAGATGTATTCAATCATTGGGCATTTTGAG GAAGCAGAAAAAGTTTTTTCTAGAATGGAATATAAAGATGTGGTGTCATGGACATCGATG ATTTCGTGTTATGGTAATAATGCACTGCCTGACAAGGCTGTGGAAACCTACAGAATGATG GAGCGAGAGGGTATCATGCCAGATGAAATAACCATAGCCAGTGTTCTATCTGCTTGTGCT TGTTTAGGGAATTTAGATATGGGTGTGAAGCTTCATGAGCTTGCTTACAGAACTGGGTTC ATATCATATGTGATAGTTGCCAATACGCTCATTGATATGTATTCTAAATGTAAATGCGTT GATAAGGCTTTGGAAGTGTTCCATGGCATCCCAGGAAAGAATGTCATATCTTGGACTTCA ATCATACTTGGCCTTCGGATCAACAATCGGTGCTTTGAGGCTTTGATTTTCTTTCGGCAA ATGAAACTCAGTCTAAAACCAAATTCTGTTACCTTGGTTTCTGTCCTGTCTGCTTGTGCT AGAATAGGAGCTTTGATGTGTGGAAAGGAAATTCATGCCCATGCATTAAGGACTGGTGTA GCATTTGATGGTTATTTACCTAATGCGCTTCTAGACATGTATGTAAGGTGTGGAAGGATG GGATCTGCATGGAACCAGTTTAACTATAACAAAAAGGATGTTGCAGCATGGAATATCCTT CTAACTGGCTATGCACAGAGGGGGCAAGGAAGGCATGCTGTTGAGCTATTTGACCGTATG GTTGAGTCCCATGCAGATCCAGATGAGATCACATTTATTTCATTGTTATGTGCTTGTAGT AGGTCTGGCATGGTTGGAGAAGGTTTGGAGTATTTTAGAAGCATGAAACTTAATTATTCC ATCACACCTAATCTCAAGCACTATGCTTGCGTTGTTGATCTACTTGGTTGTGCTGGGCAA TTGGATGATGCTCACGAGTTTATACAGAAGATGCCTATAAATCCAGATCCAGCTATATGG GGAGCTTTGTTGAATGCATGCATGATCCACAAGCAGGTTGAGCTTGGTGAACTTGCAGCT CATCAAATTTTAAAAATGGATACAGAAAGTGTTGGGTATTATGCACTTATCTGTAATCTC TATGCTCAATGCGGTAAGTGGGAAGAAGTTGCAATAGTAAGAAAGACGATGAGGAAAAGG GGCCTGACTGTAGATCCTGGGTGCAGTTGGGTGGAAGTAAAGGGAAAGGTTCATGCTTTC CTAAGTGGTGATAATTTCCACCCTCAAATAAAGGAACTAAATGCAGTGATGGAGGGATTT TATGAGAAAATGAGATCAGTGGGATTCAGAGAACCCGAAAGCAGTCCTACAGATGAAGTT GAAGCTTCAAAAGCTGAGATTTTTTGTGGACACAGTGAGAGACTAGCAGTTGCATTTGGG CTCATTAATACAGCTCCTGGGATGCCAATATGGGTGACTAAGAACCTTTACATGTGCCAA AGCTGCCACAATACTATCAAATTTATCTCTAAGGTTGTGCGTCGGGAGATTTCTGTAAGA GATACCGAAAAGTTTCACCATTTTAAGGATGGCTCCTGCACTTGTGGGGATGAAGGTTAC TGGGGAAGCTCCAATAAATGA
PEP MTVCSTSSISTQNPNSDLNELCRHGNLEKALKLLDSMQELQIKVEEDAYIALVRLCEWKR THEEGARVYSYVSNSTTLLSVKLGNALLSMFVRFGNLVDAWYVFGRMGERDVFSWNVLVG GYAKAGFFDEALNLYHRMLWVGIVPDVYTFPCVLRTCGAVPDLARGREIHVHVIRFGFES DVDVVNALITMYVKCSAVGSARMLFDRMPRRDRISWNAMISGYFENGEFLEGLRLFLMML ESSVYPDLMTMTSLISACELLGDCELGREIHGFVMRTEFAEDVSVCNALIQMYSIIGHFE EAEKVFSRMEYKDVVSWTSMISCYGNNALPDKAVETYRMMEREGIMPDEITIASVLSACA CLGNLDMGVKLHELAYRTGFISYVIVANTLIDMYSKCKCVDKALEVFHGIPGKNVISWTS IILGLRINNRCFEALIFFRQMKLSLKPNSVTLVSVLSACARIGALMCGKEIHAHALRTGV AFDGYLPNALLDMYVRCGRMGSAWNQFNYNKKDVAAWNILLTGYAQRGQGRHAVELFDRM VESHADPDEITFISLLCACSRSGMVGEGLEYFRSMKLNYSITPNLKHYACVVDLLGCAGQ LDDAHEFIQKMPINPDPAIWGALLNACMIHKQVELGELAAHQILKMDTESVGYYALICNL YAQCGKWEEVAIVRKTMRKRGLTVDPGCSWVEVKGKVHAFLSGDNFHPQIKELNAVMEGF YEKMRSVGFREPESSPTDEVEASKAEIFCGHSERLAVAFGLINTAPGMPIWVTKNLYMCQ SCHNTIKFISKVVRREISVRDTEKFHHFKDGSCTCGDEGYWGSSNK


| Top |