Cherry SNP DataBase

Gene information

Gene Pav_sc0000719.1_g360.1.mk
Chromosome name PAV_r1.0chr6
start 3179852
end 3190086
PAV_r1.0 name Pav_sc0000719.1
start 161581
end 171815
direction -
Annotation NR PREDICTED: cellulose synthase-like protein E6
Sequence CDS ATGGGCAAGCAGGAAGGTGGTGGAGAAGAAAGTCTTCCTCCATTGTTTGAGAGCAGAAGA GCAAGATTTATAGGTTTGTATAGGGTTTTTGCATCCACAATATTGGTGGGTGTGTGTTTG ATATGGGTGTATAGAGTTACAAACATCCCAAGAGCTGGAGAGGCAGGGAGGTGGGCTTGG ATTGGTATGCTCATGTCTGAGTTCTTGTTTGGGCTGTACTGGATCATTACTCAGTCTCCT AGATGGAATAAACTTCATGAAGAAATGAAGAATCGGATCGAATCTGCTGTTGCAACGGCA GAGATTCCAGTAGAAATAAAGAAGCAACACAAGGGGTTCTCAGAATGGAACCTTAAAGTT GCAAAGAATGATCATCAGTCGATTGTACAGATTATAACTGATGGAAGAGACATAAATTCC GTGGATAATGATGGATGCCGGTTACCTACGATGGTGTACATGTCACGAGAAAAGAGACCT CAGCAGCCACACAACTTCAAAGCTGGAGCTCTGAATGCACTGCTGAGAGTGTCATCAGAG ATAAGCAATGCACCCTTCATCCTCCTCTTGGACTGTGACATGTATGCAAACAATGCAGAC TCAATACGAGAGGCATTATGTTTCTTCTTGGATGAAAAGTATGGCCCTGAGATCGCTTAC GTGCAACATCCACAGGGCTATAACAATCTCACCAAGGATGATATCTATGGAAATGAATGT TTCGTTGTTAACGCGGTTGAACTTGCTGGATTAGGTGGATATGGCACGGCCTTGTTTTGT GGCACTGGATGCTTCCATCGAAGAGAATGCCTTTTTGGAAGGAAGTATTCCAAAGATTAT AGAGGACATTGGAACGTAGAGAGCCAAAAGACTATTGACAGAAGTATCAAAGAACTGGAG GAATCTGCAAAAGCTCTTATCAGTTGTAGCTATGAGAAGGGTACTCAATGGGGCAAAGAG ATGGGATTGATATATGGGTGTCCTGTTGAAGATATTGCTACTGGCTTGGCAATTCAATGC AGGGGATGGAAATCGATCTATTATAACCCAGAGAGAAAAGACTTTCTGGGTGTTGCTCCA AATACCTTAGATATAGCACTTATTCAACATAAGAGGTGGTCTGAGGGCTTGTTTCAGATA TTTTTCTCCAAATATTGCCCTTTCATTTATGGGCATGGGAAGATACACTTGGGTGCCCAG ATGGCATATTGTATCTACCTTCTGTGGGCTCCAGTTTCCTTCCCAACTTTGTATTATGTG ACTGTTCCTCCTCTTTGCTTGCTCCATGGCATTCCCTTGTTCCCTAAGGTGTCAAGCCTG TGGTTCCTAGCATTTGCTTATGTATTTATAGCCAAGAATGTTTACAGCATAGTTGAAGCC CTGAGAAGTGGTAGCACACTCAAAGCATGGTGGTACTTACAACGAATGTGGCTGATCCGA AGGATCACTTCCTACTTCTTCGCCTTCTTCGATACCATAAAGAGGCAACTGGGGCTATCT GAGACAGAGTTTGCCCTCACTGATAAGGTGATCACAGATGATGTTTCAAAGCGGTATGAG CAAGAGATTATGGAATTCGGAACCGCAAGCATTATGTATACCGTGTTAGCAACATCGGCA TTGCTGAATTTTCTGAGCTTAGTTTGGGGAACAAAGAGAGTTGTTATGGACAGGCATTAC AAAGCTTTAGACCAGTTGATCAGCCAGGTTATTCTTTCTGGCATATTAGTTCTGATCAAT TTACCGGTGTACCAAGCGCTCTTCATCCGCAGCGATAAAGGCCATATACCATCCTCTGTC ATGTTCAAAGAGAGAGAGGGAGAGAGGTCGGTCGGTCTGAATTATCAGATGGGAAAGGAA GAAGGGTATTTACCATTGTTTGAGACAAAGAGAGCCAAGGGAATAGTTCTATATAGGATT TTTGCAGCATCTATATTTGCAGGCATATGTTTGATTTGGGTTTATAGAGTAAGTCACATA CCAAAAGCAGGAGAGGATGGAAGGTTTGGGTGGATTGGATTGTTGGGCGCTGAGCTATGG TTTGGTTTTTACTGGATCCTCACTCAAGCCTCCAGGTGGAGCCCTAAATTATACAAAGAC ATGGAGAATGAAGTTGAAGATGCTGTGAAGCTAGGCCGCATTTCAGAAGAAGTAAGATCA AAACATAAAGGCTTTTCTCAGTGGGATACATATTCATCACGACGTGACCACGACACCATT CTTCAGATAAGGGTATCTTCAAACATTAGCAATGGGCAGGTCCTTCTTAATGTAGACTGT GACATGTATTCAAACAACTCTAAGGCCGTAAGGGATGCACTTTGCTTCTTAATGGATGAA GCAGAAGGCAATGAGATTGCCTATGTACAGTTCCCACAGAATTTCGAAAATGTTACTAAG AATGAATTATATAGCAATTCATTACGAGTAATCTGCGAGATGGGTTTGAAATATGGATGT CCGGTTGAAGATGTGATAACGGGGTTATCAATCCAATGCCGCGGATGGAAATCAGTGTAT TGCAATCCCACAAGGAAAGCTTTCTTAGGAATAGCTACAACCACACTGTCGCAGACACTT GTGCAGCATAAGAGATGGTCAGAAGGTGATTTCCAGATTTTGTTTTCTAAGTACAGCCCT GCATGGTATGCACATGGAAATATTAGCTTAGGTCTTCAACTTGGATACTGTTGCTACTGC TTCTGGGCTTCCAATTCCTTGGCAACCCTATTTTACTCAATTATCCCTTCACTTTATCTC CTTAGAGGCGTTTCGTTATTTCCGCAGGTATGGTTCCTCTGTCATTCATATTAA
PEP MGKQEGGGEESLPPLFESRRARFIGLYRVFASTILVGVCLIWVYRVTNIPRAGEAGRWAW IGMLMSEFLFGLYWIITQSPRWNKLHEEMKNRIESAVATAEIPVEIKKQHKGFSEWNLKV AKNDHQSIVQIITDGRDINSVDNDGCRLPTMVYMSREKRPQQPHNFKAGALNALLRVSSE ISNAPFILLLDCDMYANNADSIREALCFFLDEKYGPEIAYVQHPQGYNNLTKDDIYGNEC FVVNAVELAGLGGYGTALFCGTGCFHRRECLFGRKYSKDYRGHWNVESQKTIDRSIKELE ESAKALISCSYEKGTQWGKEMGLIYGCPVEDIATGLAIQCRGWKSIYYNPERKDFLGVAP NTLDIALIQHKRWSEGLFQIFFSKYCPFIYGHGKIHLGAQMAYCIYLLWAPVSFPTLYYV TVPPLCLLHGIPLFPKVSSLWFLAFAYVFIAKNVYSIVEALRSGSTLKAWWYLQRMWLIR RITSYFFAFFDTIKRQLGLSETEFALTDKVITDDVSKRYEQEIMEFGTASIMYTVLATSA LLNFLSLVWGTKRVVMDRHYKALDQLISQVILSGILVLINLPVYQALFIRSDKGHIPSSV MFKEREGERSVGLNYQMGKEEGYLPLFETKRAKGIVLYRIFAASIFAGICLIWVYRVSHI PKAGEDGRFGWIGLLGAELWFGFYWILTQASRWSPKLYKDMENEVEDAVKLGRISEEVRS KHKGFSQWDTYSSRRDHDTILQIRVSSNISNGQVLLNVDCDMYSNNSKAVRDALCFLMDE AEGNEIAYVQFPQNFENVTKNELYSNSLRVICEMGLKYGCPVEDVITGLSIQCRGWKSVY CNPTRKAFLGIATTTLSQTLVQHKRWSEGDFQILFSKYSPAWYAHGNISLGLQLGYCCYC FWASNSLATLFYSIIPSLYLLRGVSLFPQVWFLCHSY


| Top |