Cherry SNP DataBase

Gene information

Gene Pav_sc0000719.1_g550.1.mk
Chromosome name PAV_r1.0chr6
start 3093166
end 3111214
PAV_r1.0 name Pav_sc0000719.1
start 240453
end 258501
direction +
Annotation NR hypothetical protein VITISV_040328
Sequence CDS ATGACAGGCGGCTTCGTCGTCGAGGATGGAGTGCCTGAAGCAAAGTTGCCTGGGAGGTTT CAGTCAGACATTGATGTCACTGGAGATGATGAAGTGAACGACTCCCCCATTGAGGAAGTT AGGCTCACTGTTCCAATCACTGATGACCCATCACAGCCTACCTTGACATTTCGTACATGG GTTCTTGGGATTTTATCGTGCGCAGTTCTTGCCTTCGTTAACAAGTTTTTTGGGTACCGC ACGAATCAGCTGTCTGTTTCTTCAGTCTCGGCGCAGATTGTTGTCCTCCCTCTAGGGAAG TTGATGGCTGCAACCCTGCCAACAAGAAAATTCCGAGTGCCATTTACAAAATTGTCGTTT TCAATGAATCCGGGGCCTTTCAATTTGAAGGAACATGTGTTGATCACCATTTTCGCCAAC TCCGGAGCAGGCGGCGTTTATGCAGTTCACATTATCACAATTGTTAAGGCTTTCTACAAA AGGGGTCAGCATCCGGCGGCCGCCTTCTTGTTAGCACAAACCACTCAGCAACCAGGGCTT AATGTGATTACAGAGTTAGTTATTGGGTATATTTACCCAGGGAGGCCTCTGGCTAATGTG TCTTTCAAGACCTACGGATACATCAGCATGGCACAAGCACTCACATTTCTTGGTGACTTC AAATTAGGTCACTATATGAAGATCCCTCCTAAATCAATGTTTATGGCGCAGTTAGTGGGA ACAGTAGTGGCTTCAAGTGTGTACTTTGGCACAGCTTGGTGGCTTCTTACTTCTGTTGAC CACATCTGCGATGTGTCGAATTTGCCGGAGGGAAGTCCGTGGACATGTCCTGGTGATGAT GTGTTCTACAATGCCTCGATCATATGGGGGGTCATAGGCCCCTTCAGAATGTTCACTAGC AAAGGAGTCTACCCAGAGATGAACTGGTTCTTCCTCATTGGCTTGCTTGCACCTGTTCCC ATTTGGTTTCTCTCTAAGAAATTTCCCAACCAAAAATGGATCAGGCTCATAAACATGCCC ATCATACTTGGATCAACAAATTATATGCCCCCAGCTAAAGCAGTACATTACATAACATGG TTTGCAGTTGGAATTTTCTTCAGCTTCTATGTTTACAAAAGGCACAAGGGGTGGTGGGCT AGGCATAACTATATCCTATCTGCTGCTTTGGATGCTGGACTTGCCTTTATGGGAGTTCTC CTATATTTCACCCTTCAATCCAATAATATAAATGGCCCAGAATGGTGGGGTCTGGAAGGT GATCATTGTCCGTTGGCCACGTGTCCCACGGCGCCAGGGGTAGTTGCCAAAGGCTGTCCA AGCTCAGTTCTTGTAGTGTTGTTGTATGATGATGATGATCACCATTTCATGGAAGGTGAT GAAGTGAATGACAACCCAATTGAGCAAGTTAGGCTAACTGTTTCAACCACCGATGACCCT TCACAGCCAACCTTGACATTTCGTACATGGGTTCTTGGGATAATTTCATGCTCCGTTCTT GCTTTTATGAACCAATTTTTCGGGTACCGCCAGAATCAGCTGTATGTTTCTTCGGTCTCG GCGCAAATTCTTGTCCTCCCTCTTGGAAAGTTGATGGCTGCTACCCTTCCAGAGAAGCCA ATCCGATTCCCATTCACAAAGTGGTCGTTTTCATTGAATCCGGGGCCTTTCAACTTGAAA GAACATGTGCTGATCACCATTTTCGCCAACTCGGGATCAAACAGCGTTTACGCTGTTAAC ATTATCACAATTGTTTTGGCTTTCTACCACAGGAAAATGCATCCTGCAGCAGCCTTCTTG TTAGCTCAAACCACTCAGCAACCGGGGCTTAACGTGATCACAGAGTTAATTATCGGATAC ATTTACCCAGGAAAGCCTCTTGCTAATGTGGCTTTCAAGACCTATGGATATATCAGCATG TCACAAGGACTTATGTTTCTTCAGGACTTCAAATTAGGACACTACATGAAGATCCCTCCT AAGTCCATGTTTGTTGTGCAGTTAGTTGGAACAATAGTTGCTTCAAGTGTCTACTTTGGC ACATCTTGGTGGCTTCTCACAACCATTGAGCACATCTGTGATCCATCAAAGCTGCCAGTG GGAAGTCCATGGACATGTCCTGGTGATGATGTGTTCTACAATGCATCAATCATTTGGGGT GTCATTGGGCCCCTCAGAATGTTCACTGACAAAGGAGTCTACCCAGAGCTCAACTGGTTC TTCCTCATTGGCTTATTGGCACCTGTCCCTGTTTGGCTGCTCTCTAAACAATTTCCCAAC CAAAGGTGGATCAAGCTCATAAACATGCCCATTATACTTGGAGCCACAGGTTACATGCCT CCTGCTAGGGCTGTGAACTATTTGACATGGCTTACAGTTGGGATTTTCTTCAACTTTTAT GTGTTTAGAAAGTACAAGGGCTGGTGGGCTAGGCACAACTATATCCTCTCTGCTGCTTTG GATGCTGGTGTGGCCTTCACAGCAGTTCTGCTATATTTCATCCTCCAATCCAAGGATATC ATGGGTCCAAACTGGTGGGGCCTACAAGCTGATGACCATTGCCCGCTCGCCACGTGTCCC ACGGCACCGGATGATGAAGTGGACGACAACCCAATTGAGCAAGTTAGGCTAACAGTTCCA ATCACAGATGACCCATCAGAGCCAACCATTACATTTCGAACATGGGTGCTTGGCCTATTA TCATGCACCACTCTTGCTTTTGTCAACCAGTTTTTTGGGTACCGCCAAAATCAGCTCTTC ATTTCTTCAGTGTCTGCCCAAATTTTGGTCCTCCCGCTGGGCAAGTTGATGGCTGCGGTC CTTCCAACAACACAATTTTCAGTCCCCTTCACAAAATGGTCCTTCTCATTCAATCCGGGG CCTTTCAGTATGAAGGAGCACGTTTTGATCACCATATTTGCAAACTCTGGATCCAACAGT GTTTATGCAGTCAACATCATCACAATTGTCAAGGCTTACTACCACAGAAGTATTCATGTT ATGGCAGCCTTCTTGTTAGCTCACACCACTCAGGACTCAGTCACAGCACAGCAGATTGGT TCAGGGCTCAAGGGCCTTGGAATTGGCTCTTTTGCCCTTGATTGGTCCACCATTGCTGCC TTCTTGACCAGCCCCTTAGCCTATCCTGATGTTGCAGTCATTAACATGTTGATTGGTTTT ATTGTGATCTTTTACATTGTTACCCCCATTGCCTATTGGACCAATGCATATGATGCTAAG AGGTTCCCAATATTTTCCTCTCACACTTTTGACCATGATGGCCAAACCTACAACGTCAGT CGAATTTTGGATGAGAAAGCTTTCGATATGAATTTGAAGGAGTATAACAGTTATAGTAAA CTCTACCTCAGTGTCTACTTTGCCTACGGCTATGGATGGGGCTTTGCCACTCTCACAGCT ACTATTTCACATCAACCAGGCCTCAACATAATTACAGAGCTAATTATCGGGTATATGTAC CCAGGGAAGCCTCTTGCTAATGTGGCTTTCAAGACCTATGGATATATCAGCATGTCACAA GCACTCATGTTTCTTGGTGACTTTAAATTAGGTCACTATATGAAGATCCCTCCTAAGGAC ATGTTTTTTGTGCAGTTAGCTGGAACACTGGCAGCTACAAGTGCCTACTTTGCCACATCT TGGTGGCTTCTGACAACTGTCGAGAACATCTGCAATCCGGCAAAGTTGCCAGAGGGGAGT CCATGGACATGTCCTGGTGATGATGTGTTCTACAATGCTTCGATCATATGGGGAGTCATA GGGCCACTCAGAATGTTCACTAGCAAAGGAATCTACCCAGAGTTGAACTGGTTCTTCCTC ATCGGCCTTTTGTCACCCATTCCCGGTTGGCTGCTCCATAAAAAATTCCCCAACAAAAAG TGGATTAGGCACATAAATATGCCTGTAATCCTTGGATCAACAAGTATGATGCCACCAGCT AAAGCTGTAAACTATTCGTCATGGTTTGCAGTTGGAATTTTCTTCAACTTCTTTGTTTAC AGAAGGTACAAGGAGTGGTGGGCTAGGCATAACTATATCCTATCAGCTGCTTTGGATGCT GGAGTGGCCTTTACTGCTGTTATCCTATATTTCGCCCTCCAATCCAAGAATATTATGGGA CCAAAGTGGTGGGGTCTGGACCAAGATGACCATTGTCCATTGGCTAAGTGCCCCACAGCA CCAGGGATAGTGACCAAAGGGTGTCCAGTTTTTTGA
PEP MTGGFVVEDGVPEAKLPGRFQSDIDVTGDDEVNDSPIEEVRLTVPITDDPSQPTLTFRTW VLGILSCAVLAFVNKFFGYRTNQLSVSSVSAQIVVLPLGKLMAATLPTRKFRVPFTKLSF SMNPGPFNLKEHVLITIFANSGAGGVYAVHIITIVKAFYKRGQHPAAAFLLAQTTQQPGL NVITELVIGYIYPGRPLANVSFKTYGYISMAQALTFLGDFKLGHYMKIPPKSMFMAQLVG TVVASSVYFGTAWWLLTSVDHICDVSNLPEGSPWTCPGDDVFYNASIIWGVIGPFRMFTS KGVYPEMNWFFLIGLLAPVPIWFLSKKFPNQKWIRLINMPIILGSTNYMPPAKAVHYITW FAVGIFFSFYVYKRHKGWWARHNYILSAALDAGLAFMGVLLYFTLQSNNINGPEWWGLEG DHCPLATCPTAPGVVAKGCPSSVLVVLLYDDDDHHFMEGDEVNDNPIEQVRLTVSTTDDP SQPTLTFRTWVLGIISCSVLAFMNQFFGYRQNQLYVSSVSAQILVLPLGKLMAATLPEKP IRFPFTKWSFSLNPGPFNLKEHVLITIFANSGSNSVYAVNIITIVLAFYHRKMHPAAAFL LAQTTQQPGLNVITELIIGYIYPGKPLANVAFKTYGYISMSQGLMFLQDFKLGHYMKIPP KSMFVVQLVGTIVASSVYFGTSWWLLTTIEHICDPSKLPVGSPWTCPGDDVFYNASIIWG VIGPLRMFTDKGVYPELNWFFLIGLLAPVPVWLLSKQFPNQRWIKLINMPIILGATGYMP PARAVNYLTWLTVGIFFNFYVFRKYKGWWARHNYILSAALDAGVAFTAVLLYFILQSKDI MGPNWWGLQADDHCPLATCPTAPDDEVDDNPIEQVRLTVPITDDPSEPTITFRTWVLGLL SCTTLAFVNQFFGYRQNQLFISSVSAQILVLPLGKLMAAVLPTTQFSVPFTKWSFSFNPG PFSMKEHVLITIFANSGSNSVYAVNIITIVKAYYHRSIHVMAAFLLAHTTQDSVTAQQIG SGLKGLGIGSFALDWSTIAAFLTSPLAYPDVAVINMLIGFIVIFYIVTPIAYWTNAYDAK RFPIFSSHTFDHDGQTYNVSRILDEKAFDMNLKEYNSYSKLYLSVYFAYGYGWGFATLTA TISHQPGLNIITELIIGYMYPGKPLANVAFKTYGYISMSQALMFLGDFKLGHYMKIPPKD MFFVQLAGTLAATSAYFATSWWLLTTVENICNPAKLPEGSPWTCPGDDVFYNASIIWGVI GPLRMFTSKGIYPELNWFFLIGLLSPIPGWLLHKKFPNKKWIRHINMPVILGSTSMMPPA KAVNYSSWFAVGIFFNFFVYRRYKEWWARHNYILSAALDAGVAFTAVILYFALQSKNIMG PKWWGLDQDDHCPLAKCPTAPGIVTKGCPVF


| Top |