Cherry SNP DataBase

Gene information

Gene Pav_sc0000720.1_g010.1.mk
Chromosome name PAV_r1.0chr8
start 13313914
end 13341023
PAV_r1.0 name Pav_sc0000720.1
start 1
end 27110
direction +
Annotation NR PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase TOR
Sequence CDS ATGTCACCGACAATTTCAGCGGCTTCCAAGGTCACTACGTCTCCAAGAAAGAAAATCTTG GCGGAGAGGAACGGGCCAGTTCGGGCTTCATCGGTCTCATTCTCCGATTTGAAAAGCTCG TGTTTGAATCCAACAGTGGAGGATCCAGAGCACATGAAGGTAGGCCTTGCCCCTCATCTG GTTTTCACAACACCGAAAACCCAAAAAGACATTTGTTCAAAGGAGCTCTTGTGTTCCAAA AACGAACCAGAGGAACCTGTTTGTGTAAATGCCTCTGAGGAACCTGACTCGGTTAATCTT GACCCGAGTTTCAAGATCAGTCCTCCACCTTGTTGTCCAAAGTCCAGTCCGGTCATAGAA CCCCTTGATGATGATCCCTCTGCTCCTCCTTACGATCCTAAAACGAATTATCTTTCTCCA AGGCCTCAGTTCCTTCATTACAGACCCAACCCAAGAATTGAATATTATCTGATCTTCCTT CATTACAGACCCAACCCAAGAATTGAATATTATCTGAGTAAGGAAAGAGAGGGCAAGAGA CTTGAGGATAACTTCATCTCTGGAAGCTCTTCGGACACTGATACTGCTGAGGAAACTCAG TCTGAATATTCTCAGAAGGAATTGGAAGATGTTACTTCTGATGCAGTAGTAAAAGAGGAA CAGCAGCTACAAGAAGAAAATGAAGAAGAAGAGGAAGAAGAGGAAAAGCAGGGGGTCAAT GTGTCTGAACCACGCGACATTAGCACCACCAACATTTTTATGTCAAAGGAGGAGGCTGCT GAAGTAAAATGGTCCTCCAAGACAGGCTTCTTTTGGAAATCAAAGTTCACTGCTTTGCTT CTATTGTTGGTAGTTGCTTTTTTGTCAGTTTCAGTTATTCATTCACCAGAAATTGATAGT TCTGTGCTTAAAGACTTGAACTTTTTGAAGGAATATGACCAGTCTGAAGTGGCTGAATTT GCTAGATCAAGTCTTGATGGGTTAGCTAGAAATTTTCGGGTTTGGTCTGCTAATTCTGTC TCTTTCATTTCTGAGTTGATTTTGCATCTCCGAGGTGCACACGATTTGGGCCCCTTGCAG TATTGTAATTTGACTGATTTAATGGAGGATGTACGGGTTGATGGATACTCTGTGTTTGAT CACAGTGACAAAGGAAAGGAAAGGAAGTATGAGTTTGATTTAGTTGACATTGAAGCCTTG GGAGAGAAGGGTCAGACAGAGATTGGTGCAGCTGAAAACACTGTAGAAGTACATGCTGAT CCAGAATATGAAGAACAAGTTAATGAAGAGGCTGAAACACCTGTTGAAATCCAAGTTGTG GAAGAAAAGGGTCAGCCAGAGATTGGAGCAGTTGAGAGCACTGTAGAAGTAGCACGTGTT GATCCGGAACATGAAGAACAAGTTGACCAAGAGGCTGAAGCAGCTGTTAACATTGAAGAG GTTTCAGAAGGAAACAATAATTTTATTTCTGGGGAAGTTGTACTTCAGTCTGCACATGCT GATTTAGTTGAACTAGAAAGTTCAAAAGTTGAGCAGAGTCAAGAAGAAAATGTTGGTGCT GATCACATAGACAGCGAGCCAGAAAGTAATGTAAGCATGAGGGAGGAGATAGTATTGATT TCACTAGCAGAAAAAGTTAACACTGTAGTTTCTGGAGTCCAGGAGCTCCAGCTTGAAAGT GAAATGAGTACTGGTGCTGAAGTAGAGTCTTTCAAGGATCACAGTCCTATAAGCCCAAAA GTGGATGCTTCATGTGTGAATGTTCAAACTTCAGAAGAAGTGGATCTTACCGTTGATGAG ACTGAATTTAAGGTTTCCATGGTGACTATGCTGGGAATTGCTTCCGAGATGGCGGTCTCG GGGCAGTCCATCAGGTTCTGCGGTCCCGCCTCTGCCGGNNNNNNNGGTCCCGCCTCTGCC GGACCCGGCGGAGGCAGTTTCGACGCGCTCAATCGCGTCCTTGCTGACCTCTGCACCCGA GGCAACCCCAAGGAGGGGGCTTCATTAGCTTTGAAGAAGCATCTGGAAGAAGAAGCCCGT GACCTCAGTGGAGAAGCATTTTCCCGTTTCATGGATCAGTTGTATGATCGGATTTCATCT CTTCTGGAGAGCAGTGATGTTGCGGAGAACTTAGGAGCTCTAAGAGCTATTGATGAGTTG ATAGATGTGGCATTTGGAGAGAATTCCTCAAAGGTTTCAAAGTTTGCTAATTACATACGT ACTGTGTTTGAGGTAAAGCGTGATCCAGATATTTTGGTCCTAGCTAGTAGAGTTCTGGGC CATCTAGCCAGAGCAGGGGGAGCGATGACTGCAGATGAAGTGGAACGCCAGATAAAAATT GCTCTGGGGTGGTTGCGCGGGGATAGAGTCGAGTATCGACGTTTTGCTGCTGTCTTGATC TTGAAAGAAATGGCAGAAAATGCTTCAACAGTGTTCAATGTTCATGTACCTGAATTTGTT GATGCTATTTGGGTTGCTTTGAGGGATCCGATGTTGCCTATTCGAGAGCGAGCTGTGGAA GCTCTGCGTGCTTGCCTTGGTGTTATTGAGAAACGTGAGACACGCTGGCGTGTGCAATGG TATTATCGTATGTTTGAGGCCACTCAGGATGGGTTGGGTAAAAATGCTTCTGTTCACAGC ATACATGGTTCTTTACTTGCAGTTGGAGAGCTTTTGAGGAATACAGGTGAATTTATGATG TCAAGGTACAGAGAAGTTGCAGAAATTGTCCTTAGATATCTTGAGCACCGCGATAGGCTG GTTCGCCTGAGCATAACTTCGTTGCTACCTCGAATTGCTCATTTTCTGCGTGATCGATTT GTCACAAACTACTTAACGATATGTATGAATCATATTCTTGCTGTTTTGCGAATACCAGCT GAGCGCTCCAGTGGTTTTGTTGCCCTTGGGGAGATGGCTGGTGCTTTGGACGGGGAACTT GTCCACTATTTGCCGACAATTACGTCTCACTTACGTGATGCGATTGCTCCACGTAGAGGT AGACCCTCGCTTGAGGCTTTGGCTTGTGTTGGAAACATTGCAAAAGCAATGGGGCCTGCC ATGGAACCTCATGTTTGTGGTCTTTTGGATGTTATGTTCTCTGCTGGCCTTTCCCCTACG CTTGTTGAGGCCCTTGAGCAGATTACTACCAGTATTCCATCTTTGCTGCCTACCATCCAA GATCGGTTGCTTGACTGCATTTCAGTGGTTCTTTCAAAATCCCATCATCCTCAGGGAAGG TCAGCTGTTGGCATGGGTAGAGGAAATTTAATGAATATGCCTCAGCAAGTCTCGGACCTC AGTGGTTCAGCCCTCGTGCAGCTTGCTTTGCAGACTCTAGCTCGTTTTAATTTCAAGGGC CATGACCTTCTTGAGTTTGCGAGAGAATCAGTTGTTGTATATTTGGATGATGACGATGGA GCCGTCCGAAAAGATGCTGCCCTCTGTTGTTGCAGATTAGTTGCAAATTCCTTTTCTGGT GTGCAATATGCTTCGGGTAGGTCCAATCGAGGAAAGCGACGACGTCTTGTTGAGGAGATT GTGGAAAAGCTTCTCATCGAAGCTGTTGCAGATGCTGATGTTATTGTTCGCCATTCAATC TTTTCCTCTCTGCATGGGAATAGAGGTTTTGATGATTTTTTGGCGCAGGCTGATAGTCTG AGCGCAGTTTTTGCTGCTTTAAATGATGAGGATTTTGATGTTCGAGAGTTTGCAATTTCT GTGGCTGGGAGGTTGTCAGAAAAAAATCCTGCTTATGTCCTTCCAGCACTTCGACGCCAT CTCATACAGTTGCTGACTTACCTGGGGCAGAGTGCAGATACCAAATGCCGGGAAGAAAGT GCGAAGTTACTCGGTTGTTTAATACGGAATTGTGAACGGCTAATACTTCCATATATTGCT CCAATACACAAGGCACTCGTAGCAAGACTTATTGATGGCACCGGTGTCAATGCAAATAAT GGCATTATTAGTGGAGTTCTTGTAACTGTTGGGGATCTTGCTAGAGTGGGTGGTTTTGCA ATGCGAAGATACATTCCGGAGCTTATGCCTTTGATTGTTGAAGCTTTATTGGATGGAGCA GCTGTCACAAAACGGGAAGTGGCAGTTGCCACTCTTGGTCAAGTTGTACAGAGCACTGGG TATGTACTGTGTGTAGGTCTTGCATGTTCTAGTGAGCTGGGAAGACTCTGGTTTGAGAAG TTTGACAGGTATGTAATAACTCCATACAATGAGTATCCACTGTTACTTGGCTTACTCTTG AAGTTGCTGAATGGTGAATTAGCATGGTCTACAAGACGTGAAGTACTAAAGGTTGCAATC AATTCTCTCATGCGTATACTTAGGGACCCTTCACTTGCTACTTACCACCTAAAGGTGGTC GGATCCCTTATGTTTATATTCAAGGTTTTGCCTGATCTCTTCCATATAGTCCGTACATGT GATGATGCTTTAAAGGATTTTATAACATGGAAGCTTGGAATTCTAGTATCTATTGTGCGT CAGCACGTCCGGAAGTATCTGCAGGAGTTACTCATTCTAATTTCAGAACTATGGTCAACC TTCAGTTTTCCGGCTGCAGGCCGTCCTCAACTTGGCTATCCAGTTCTGCATCTGGTGGAG CAGCTTTGCTTAGCTCTCAATGATGAATTCCGAACATACCTTCCTGCTATTCTTCCATGT TGTATTCAAGTTCTAAGTGATGCAGAACGGTATAATGATTATACTTATGTTCTTGACATC CTCCGTACCCTTGAAGTGTTTGGTGACTCATTTCAGCTTCAAAATGTAGGAACATTGGAT GAACATATGCATCTGCTTCTTCCTGCACTCATTCGCTTGTTTAAAGTGGATGCTTCAGTG GATATAAGACGTGCTGCTATCAAAACTTTGACAAAATTGATCCCTCGTGTGCAGGTTACT GGTCACATATCTTCTCTTGTGCATCACTTGAAGCTAGTCTTAGATGGGTCTGTTTCCTCT TTCCTTGGCTTTGAATAG
PEP MSPTISAASKVTTSPRKKILAERNGPVRASSVSFSDLKSSCLNPTVEDPEHMKVGLAPHL VFTTPKTQKDICSKELLCSKNEPEEPVCVNASEEPDSVNLDPSFKISPPPCCPKSSPVIE PLDDDPSAPPYDPKTNYLSPRPQFLHYRPNPRIEYYLIFLHYRPNPRIEYYLSKEREGKR LEDNFISGSSSDTDTAEETQSEYSQKELEDVTSDAVVKEEQQLQEENEEEEEEEEKQGVN VSEPRDISTTNIFMSKEEAAEVKWSSKTGFFWKSKFTALLLLLVVAFLSVSVIHSPEIDS SVLKDLNFLKEYDQSEVAEFARSSLDGLARNFRVWSANSVSFISELILHLRGAHDLGPLQ YCNLTDLMEDVRVDGYSVFDHSDKGKERKYEFDLVDIEALGEKGQTEIGAAENTVEVHAD PEYEEQVNEEAETPVEIQVVEEKGQPEIGAVESTVEVARVDPEHEEQVDQEAEAAVNIEE VSEGNNNFISGEVVLQSAHADLVELESSKVEQSQEENVGADHIDSEPESNVSMREEIVLI SLAEKVNTVVSGVQELQLESEMSTGAEVESFKDHSPISPKVDASCVNVQTSEEVDLTVDE TEFKVSMVTMLGIASEMAVSGQSIRFCGPASAGXXGPASAGPGGGSFDALNRVLADLCTR GNPKEGASLALKKHLEEEARDLSGEAFSRFMDQLYDRISSLLESSDVAENLGALRAIDEL IDVAFGENSSKVSKFANYIRTVFEVKRDPDILVLASRVLGHLARAGGAMTADEVERQIKI ALGWLRGDRVEYRRFAAVLILKEMAENASTVFNVHVPEFVDAIWVALRDPMLPIRERAVE ALRACLGVIEKRETRWRVQWYYRMFEATQDGLGKNASVHSIHGSLLAVGELLRNTGEFMM SRYREVAEIVLRYLEHRDRLVRLSITSLLPRIAHFLRDRFVTNYLTICMNHILAVLRIPA ERSSGFVALGEMAGALDGELVHYLPTITSHLRDAIAPRRGRPSLEALACVGNIAKAMGPA MEPHVCGLLDVMFSAGLSPTLVEALEQITTSIPSLLPTIQDRLLDCISVVLSKSHHPQGR SAVGMGRGNLMNMPQQVSDLSGSALVQLALQTLARFNFKGHDLLEFARESVVVYLDDDDG AVRKDAALCCCRLVANSFSGVQYASGRSNRGKRRRLVEEIVEKLLIEAVADADVIVRHSI FSSLHGNRGFDDFLAQADSLSAVFAALNDEDFDVREFAISVAGRLSEKNPAYVLPALRRH LIQLLTYLGQSADTKCREESAKLLGCLIRNCERLILPYIAPIHKALVARLIDGTGVNANN GIISGVLVTVGDLARVGGFAMRRYIPELMPLIVEALLDGAAVTKREVAVATLGQVVQSTG YVLCVGLACSSELGRLWFEKFDRYVITPYNEYPLLLGLLLKLLNGELAWSTRREVLKVAI NSLMRILRDPSLATYHLKVVGSLMFIFKVLPDLFHIVRTCDDALKDFITWKLGILVSIVR QHVRKYLQELLILISELWSTFSFPAAGRPQLGYPVLHLVEQLCLALNDEFRTYLPAILPC CIQVLSDAERYNDYTYVLDILRTLEVFGDSFQLQNVGTLDEHMHLLLPALIRLFKVDASV DIRRAAIKTLTKLIPRVQVTGHISSLVHHLKLVLDGSVSSFLGFE


| Top |