Cherry SNP DataBase

Gene information

Gene Pav_sc0000729.1_g070.1.br
Chromosome name PAV_r1.0chr4
start 6672865
end 6674484
PAV_r1.0 name Pav_sc0000729.1
start 30062
end 31681
direction +
Annotation NR PREDICTED: tetrahydrocannabinolic acid synthase-like
Sequence CDS ATGGAGATCTCTCAAGTAAAACTAGTTCAAGTCCTACTTTTCATCCTTCTCAATTCAGTT TGGTGCACAACTTCAAACTCAATTTCTGAAAGCTTTCTTCAATGCTTTTCCTCCCACATA CCTTCAAACTCAAGCAGCAAAATTATTATCACCAAAAACAGTCCTGCTTATTACCCAGTC TTGCAATTTTCCATACAGAATCTCAGATTCTTCAACACTCCAACACCAAAACCAGAAGTT ATCATTACTCCTTTTAAACACTCTCATGTTCAAGCAGCTGTAATTTGTTCCAAGAAAGAG GGCATACAAATAAGAACCCGAAGCGGGGGGCATGACTACGAGGGCCTATCTTATGTATCG ATAGCTCCTTTCATCCTGATTGATCTTTTCGAACTTCGGTCCATTGATATTGACATAGAG AATGAGATCGCTTGGGTCGAATCTGGTGCTACTCTCGGGGAGTTGTATTATGCAATTGCA CAAAAGAGTAAAGTCCATGGCTTTCCAGCAGGGACTTGTCCAACTGTTGGTGTGGGGGGC CATATTAGTGGAGGTGGATATGGTACCTTGTTCAGGAAGTATGGTATGGCAGCTGACAAT GTCCTTGATGCTAAGATTGTCGACGTTAATGGCAGAGTTCTTGACAGAAAATCCATGGGA GAAGAACTCTTTTGGGCTATTAGAGGAGGGGGAGGCGCAAGCTTTGGAGTCATTCTATCA TGGAAACTTAGGTTGGTTCCGGTTCCTCCAACTGTAACAACTTACGTGGAATCAAAGACC ATGGAACAAGGTGCAACCGAACTTGTTTCTAAATGCCAGGCAATAGCAGATTGGATGCCT GAAGGGTATTTCCTGCGTGTGGTTTTAGGAGTTACAAATGGTACAAACGGTGGAAAAACT ATTCAAGTTGAACTCAGTTTCTTGTTTCTTGAGACTTATGAGGAACTTCTTCCTTGGATG AAAGAAAACTTCCCAGAGTTAAATTTAGACCGGACCGCATTCACTGAAATGAGTTGGATT CAGTCTATTCTATATTCCGCTGACTACTCAATAAATGATACAGAAGTTCTGCTTAACCGG AGTCAACAATCTAGGAGCTTCTTCAAAGGAAAATTAGACTACGTGACAGAACCAATTTCA GAAGCTGGCATGGAAGGTTTATATCAGATAATGTTTCAACTAGACACATCCACGGTGATA CTGACACCTTTTGGCGGAATAATGAGTGAGATTTCCGAATCAGAAATTCCTTTCCCACAT AGAAAAGGAAACTTATATGAAATCCAGTATTTTGTCAGTTGGGATGATGACAAAGAAAGT GAGAAAGATGTTAGCTGGACAAGAAGGGCGTATGGCTACATGGCAGCATATGTTTCCAAG TCCCCAAGAGGTGCCTATTTGAACTGCAGGGATCTTGACTTGGGGATAAACAAGGATGCT AACACAAGCTATGCAGAAGCAAGCATTTGGGGTTTGAGCTACTTCAAGAATAACTTCAGG AGACTTGCTCAAGTGAAGACCGTAGTTGATCCTGGTAACTTCTTTTTTAATGAACAAAGC ATCCCTGTGTTACGATCTGGAAAAATGAAATGGCAACAACAACTAGATGTGTCTCTGTAA
PEP MEISQVKLVQVLLFILLNSVWCTTSNSISESFLQCFSSHIPSNSSSKIIITKNSPAYYPV LQFSIQNLRFFNTPTPKPEVIITPFKHSHVQAAVICSKKEGIQIRTRSGGHDYEGLSYVS IAPFILIDLFELRSIDIDIENEIAWVESGATLGELYYAIAQKSKVHGFPAGTCPTVGVGG HISGGGYGTLFRKYGMAADNVLDAKIVDVNGRVLDRKSMGEELFWAIRGGGGASFGVILS WKLRLVPVPPTVTTYVESKTMEQGATELVSKCQAIADWMPEGYFLRVVLGVTNGTNGGKT IQVELSFLFLETYEELLPWMKENFPELNLDRTAFTEMSWIQSILYSADYSINDTEVLLNR SQQSRSFFKGKLDYVTEPISEAGMEGLYQIMFQLDTSTVILTPFGGIMSEISESEIPFPH RKGNLYEIQYFVSWDDDKESEKDVSWTRRAYGYMAAYVSKSPRGAYLNCRDLDLGINKDA NTSYAEASIWGLSYFKNNFRRLAQVKTVVDPGNFFFNEQSIPVLRSGKMKWQQQLDVSL


| Top |