Cherry SNP DataBase

Gene information

Gene Pav_sc0000759.1_g440.1.mk
Chromosome name PAV_r1.0chr3
start 3809287
end 3815664
PAV_r1.0 name Pav_sc0000759.1
start 254920
end 261297
direction +
Annotation NR PREDICTED: ATP-dependent zinc metalloprotease FtsH
Sequence CDS ATGGCCTGCCAATGCCTTCTGGGCTCTTACTCATCTTCTTCTCTATCCCCAAACCCCAAA CCCCAAACCCTCAATAAAAACCCACCAAAACCTCTCGCTCCATCCTCCATTTCCTCCCAC CTCTCAATCACTGATGATAATGATGAAAACGATAAAACCCAGAAACCCAATTTCGATTTC CTCAAGCTTTCTGTAACTCTCACTGTAATCTCCACCGCTCTCCCCCAAATCCCAACCGGC ATAGCCGCCGTCAAAGAGAAAAAGCGAGTGCCCAAGAAGTCCACGCTCAAAAAATCCGAA GCTTTATCTCATCAAGAGCTCGAGTCTTGGTCCCATGGCCTCCCCGTCGTCTCCAATCGA ATTCCGTACACCCAGCTCTTGATATTGAACCAGGAAGGTAAGCTCAAACATGTTATCAAG CCTCCTGGTGTTGAATTGCAAAAAAGGGTAGAGCCCGTATTGGTTGTTCTAGAAGATAAT CGGGTTCTACGCACCGTTTTGCCTTCGGTGGATAGCGATAGGAGATTTTGGGAACAATGG GAAGAGTTGAAAATCGAGTCTTTGTGCGTCAATGCATATACGCCGCCGCTTAAACGGCCG GAGGTTCCGTCACCGTACTTGGGTTTTGTGGCGAAATGGCCGGCGTTTTTGTCGTCGTTT GTGAAGCCGAAGAAGGAGAGCAAGAGAGCTATGGAGTTGAGGAGAGCGAGGGAGGAGTTT AAGACACAGAGGAAGGAGGAGCTTGAGAGAATGAGGAAGGAACGAGATATGATCGATAAG GCCATGAAGGCCCAGAAGAAAGAGGAGGAGAGGAGAGTGAAGAAAGAGGTGAGGAAGAAG AAACATGATGAGTCCTTGCGTCAGGCACGTAGGAATTATCTGGAGATGGCCAATGTATGG GCCAATTTGGCTCAGGACTCCAATGTTGCCACTGCGCTTGGACTGGTGTTCTTCTATATT TTTTACAGGACCGTAGTGTTTAGTTATAGGAGGCAGAAGAAGGACTATGAGGATAGGTTG AAGATTGAAAAGGCGGAGGCGGAGGAGAGGAAGAAAATGAGGGAATTGGAGAGGGAGATG GAGGGGATTGAGGGTGAGGAGGAGGAGGAGATTGAGCAAGGGAAGGGTGAGCAAAACCCT TATTTGAAAATGGCTATGCAGTTCATGAAGTCTGGGGCTCGGGTGCGACGAGCTCATAAT AAGAGGCTGCCTCAGTATTTGGAGAGAGGCGTGGATGTCAAGTTTTCGGATGTAGCCGGC CTTGGGAAGATCCGGCTTGAGCTTGAGGAGATTGTCAAGTTCTTCACTCACGGTGAAATG TATAGGAGAAGAGGAGTTAAAATACCAGGTGGGATACTTCTTTGTGGCCCTCCTGGAGTG GGTAAGACCTTGCTTGCAAAAGCTGTAGCTGGTGAGGCAGGCGTCAACTTCTTTTCCATT TCGGCCTCTCAGTTTGTGGAGATATATGTTGGGGTTGGTGCATCTCGTGTCCGAGCACTT TATCAGGAAGCAAGGGAAAACGCTCCATCGGTTGTCTTCATTGATGAGTTGGATGCTGTT GGAAGGGAGCGTGGTTTGATCAAGGGTTCTGGTGGGCAAGAACGTGATGCTACTCTTAAT CAGCTCCTTGTTTCCTTGGATGGGTTTGAAGGAAGAGGTGAAGTGATCACTATTGCTTCC ACAAATAGACCAGACATTCTAGATCCAGCTCTTGTCAGACCTGGACGGTTTGATCGAAAG ATATACATCCCTAAGCCTGGTCTTATAGGTCGCATTGAAATTTTGAAGGTTCATGCACGC AAGAAGCCTATGGCTGAAGACGTGGACTATATGGCTATTGCTAGTATGACTGATGGAATG GTTGGTGCAGAGCTAGCTAACATAGTTGAGGTTGCCGCAATCAACATGATGCGTGATGGA AGGACTGAGATTACTACTGATGACCTATTACAAGCTGCACAAATGGAAGAAAGAGGAATG CTGGATAGGAAGGAGAGAAGTTTAGATACATGGAAGCAAGTAGCTATTAATGAGGCTGCA ATGGCTGTTGTTGCTGTGAACTATCCTGACCTTAAAAATATTGAGTTCGTCACAATTGCT CCTAGAGCTGGTAGGGAGTTGGGTTATGTGAGAATGAAAATGGATCCTATCAAGTTCAAA GAAGGAATGCTTACTCGGCAATCACTCCTGGATCATATCACTGTTCAACTGGCACCACGT GCAGCTGATGAACTTTGGTTCGGTGAGGATCAGTTAAGTACTATATGGGCTGAAACGGCA GACAATGCTAGGTCAGCCGCACGAACGTATGTTCTTGGTGGCCTTTCAGAGAAACATCAC GGGCTATCTAATTTCTGGGTTGCAGATCGACTCAATGACCTTGATACGGAAGCATTGCAA ATTGTCAACATGTGTTATGAACGTGCAAAAGAGATTCTGCAGAAAAACCGAAAGCTCATG GATGCGGTGGTGGATGAACTTGTCCAGAAGAAGAGTTTAACCAAACAAGAATTCTTTAGC CTAGTTGAGTTACATGGTTCAATCAAACCTATGCCACCTAGCATACTTGACATCAGGGCT GCCAAACGGAAGCAGTTCCAAGATATGATGATGAACCAAAAGGAACCAGCTTTGGGGAGC AACTTATGA
PEP MACQCLLGSYSSSSLSPNPKPQTLNKNPPKPLAPSSISSHLSITDDNDENDKTQKPNFDF LKLSVTLTVISTALPQIPTGIAAVKEKKRVPKKSTLKKSEALSHQELESWSHGLPVVSNR IPYTQLLILNQEGKLKHVIKPPGVELQKRVEPVLVVLEDNRVLRTVLPSVDSDRRFWEQW EELKIESLCVNAYTPPLKRPEVPSPYLGFVAKWPAFLSSFVKPKKESKRAMELRRAREEF KTQRKEELERMRKERDMIDKAMKAQKKEEERRVKKEVRKKKHDESLRQARRNYLEMANVW ANLAQDSNVATALGLVFFYIFYRTVVFSYRRQKKDYEDRLKIEKAEAEERKKMRELEREM EGIEGEEEEEIEQGKGEQNPYLKMAMQFMKSGARVRRAHNKRLPQYLERGVDVKFSDVAG LGKIRLELEEIVKFFTHGEMYRRRGVKIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSI SASQFVEIYVGVGASRVRALYQEARENAPSVVFIDELDAVGRERGLIKGSGGQERDATLN QLLVSLDGFEGRGEVITIASTNRPDILDPALVRPGRFDRKIYIPKPGLIGRIEILKVHAR KKPMAEDVDYMAIASMTDGMVGAELANIVEVAAINMMRDGRTEITTDDLLQAAQMEERGM LDRKERSLDTWKQVAINEAAMAVVAVNYPDLKNIEFVTIAPRAGRELGYVRMKMDPIKFK EGMLTRQSLLDHITVQLAPRAADELWFGEDQLSTIWAETADNARSAARTYVLGGLSEKHH GLSNFWVADRLNDLDTEALQIVNMCYERAKEILQKNRKLMDAVVDELVQKKSLTKQEFFS LVELHGSIKPMPPSILDIRAAKRKQFQDMMMNQKEPALGSNL


| Top |