Cherry SNP DataBase

Gene information

Gene Pav_sc0000764.1_g080.1.mk
Chromosome name PAV_r1.0chr1
start 5680896
end 5686960
PAV_r1.0 name Pav_sc0000764.1
start 26179
end 32243
direction +
Annotation NR PREDICTED: probable E3 ubiquitin-protein ligase XBOS32
Sequence CDS ATGAAATTTCTCAGCGTTATGGGAAATTCATTTGGATGTTCAGCATCCGGGGAGCGATTA GTTTCAGCAGCAAGAGATGGAGATCTTCAAGAGGCTAAGGCCTTGCTGGAATGTAATCCT CGCCTGGCAAGGTACTCGACTTTTGGTGTTCGTAATTCCCCTCTCCATTATTCTGCAGCT CAGGGCCACCATGAGATAGTCTCTCTCTTGCTAGAGTCTGGAGTCGATATCAATCTCCGG AATTATCGTGGTCAGACTGCTTTGATGCAAGCTTGCCAACATGGTCATTGGGAGGTTGTT CAGACATTGGTTCTTTCTAAAGCCACAATTCACAGAGCAGATTATCTGAATGGGGGTACT GCACTCCACTTTGCTGCTTTGAATGGTCATTCTCGGTGCATCCGGCTCCTCCTTGCTGAT TACATTCCCAGCACTCCGGATTTTTGGAGTACCTTAAGGAATGCATCAAGCAATGAAGAA TCAATTGTGGAGTTTAACCATGAGCCTGCTGATGGAGGAATCACTGCACTGCATATGGCA GCGTTGAACGGTCATGTTGAAAGCGTACAACTACTTTTGGATTTAGGGGCTTCTGTTTTT AAGGTTACTGTGCAAGATGGAACTACAATTGATCTAATAGGTGCTGGAAGCACAGCCCTA CATTATGCTGCATGCGGGGGAAATGCACAGTGTTGTCAAATTTTGATTTCCAGGGGTGCC AGTCTGAATGCTGAAAATGCGAATGGATGGACTCCCTTGATGGTGGCCCGTTCTTGGCAT AGAGACTGGCTCGAGGAAATCCTAAGCACGGAGCAGCAAGTCCAGTCACAAATTCTTCCT TCACCGTACCTATCCCTTCCCCTTATGAGTATTGTGAAGATTGCTAGAGAATGTGGATGG AGGAACAGTGATTCTTTATCTACATGCCAAGATCCATGTGTAGTCTGTTTGGAACAGCAG TGCACAGTGGCTGCGGAAGGTTGTGATCATGAGTTTTGCACAAGATGTGCCTTGTACCTT TGTTCCACAAACTGCACTACAACTGTGTCTCATGGTCCCCCAGGCTCAATTGCATGTCCT CTCTGCCGAAGTGGCATAGTTTCATTTGTGAAGCTTAGAGGAACAAGATCAGTGGTTAAG GAGAATCCAAGAACAAGTTTATCCCTATCGTTGTGCTCATGTTCTGCTGAGGCGCCAGAT TCCACCTCAATAACGACCCCGTTGTGCAAGCCTGAGTTCCGTTGCTCTGGTAAATCTCCT CTCGGATCTTTCCGGTCCTTGAGCTGCCAGAAGTTCCCATCATTCAAGATCAACTACAAC CTTTGCATGGGAGCTCCAAATATTAATCCTTGTTTGGTTCCAAGCTCCGGTAATAGGAAG TTGCGGAACCATTTGGCTAGGTGCTCTAGATCCGGCTTTAGACGATCAGCATCTCAACCT GAGGGCAGAAGGTCATGGTTTTCTGCACTCAATCAAAATGTAACGACTGGCAGTGGATGC TGA
PEP MKFLSVMGNSFGCSASGERLVSAARDGDLQEAKALLECNPRLARYSTFGVRNSPLHYSAA QGHHEIVSLLLESGVDINLRNYRGQTALMQACQHGHWEVVQTLVLSKATIHRADYLNGGT ALHFAALNGHSRCIRLLLADYIPSTPDFWSTLRNASSNEESIVEFNHEPADGGITALHMA ALNGHVESVQLLLDLGASVFKVTVQDGTTIDLIGAGSTALHYAACGGNAQCCQILISRGA SLNAENANGWTPLMVARSWHRDWLEEILSTEQQVQSQILPSPYLSLPLMSIVKIARECGW RNSDSLSTCQDPCVVCLEQQCTVAAEGCDHEFCTRCALYLCSTNCTTTVSHGPPGSIACP LCRSGIVSFVKLRGTRSVVKENPRTSLSLSLCSCSAEAPDSTSITTPLCKPEFRCSGKSP LGSFRSLSCQKFPSFKINYNLCMGAPNINPCLVPSSGNRKLRNHLARCSRSGFRRSASQP EGRRSWFSALNQNVTTGSGC


| Top |