Cherry SNP DataBase

Gene information

Gene Pav_sc0000764.1_g110.1.mk
Chromosome name PAV_r1.0chr1
start 5706022
end 5710574
PAV_r1.0 name Pav_sc0000764.1
start 51305
end 55857
direction +
Annotation NR PREDICTED: GPI mannosyltransferase 3
Sequence CDS ATGAGGCAAAGGCAGAATGTTGCTGTTTCATCAGCAGCAGAAACAGACAGAACCCAAAAC CCAATTCCTTCAAAATCAGACCCACAACAAAAGAAAGCGCAAAGCTTTGATTTTCTAGGC TCTTCGAAGAAAGTCTTTGCACTCTGCTTCGCTTTTCGAATAGCGAATGCTCTGTTGGTT CAAACCTATTTCAACCCAGATGAACACTGGCAAGCCCTTGAAGTAGCACACCGCATCACT TTCGGGTATGGCCATTTGACTTGGGAGTGGGAAAAGGGGATCCGTAGCTATTTGCATCCT TTGCTCTTTGCTTTGCTTTACAAACTGCTTGCAGTGTTGGGTCTTGACACCCCATGGTTC ATGGTCAGGGCTCCACGGCTGTTTCAGTCCTTTTTTTCTGCATTTGGTGATTTATACTTG TACAAACTCTCTGTCATCCTCTTTGGTCATTGCGTTGCAAAGTGGGCTGTATCCTTTTGT ATGAGGGTCACTTTCAATTACTATTACTCACAGACGCACTATGGTAAACATCTTTTTGTT TGTGGTAGACTCTTTTCACAATTGACAAATTGGTTTATGTTTTACTGCCTCACTCGTACG TTATCAAATAGTTTGGAGACTGTTCTTACCCTTGTGAGCCTGTACTACTGGCCCTGTATG AGGCCTTCTTCCAGCAAACTTCCTTTGGAATCAAGGAAGTGGGGTTTGGTTATTGCCGCA TTAGCTTGTGCTATTCGACCAACAAGTGCTATCATATGGCTGTATGTTGGACTTCTTGAG CTATTTGTGACACGTGATAAACTGAGATTCATTTTTCTGGAGGTTGCTCCTATGGGGCTC CTGGTGCTCGGGCTTACATTTTTGTTGGATCGTTTGATGTACGGTTCATGGGTCTTAGTA CCTCTTAATTTTCTAAAGTTCAATTTCCTTTCTGCTGGTGGAGATTATTATGGGACTCAC AAGTGGCACTGGTACTTCACTCAGGGATTTACTGTCATGATATTCTCCTTCTTACCATTT TCTGTAGCTGGCATCATGCAGTCCAAACATTGGAAGCTTTCTGGCCTTATTGCATGGGTT TTAGGACTTTATAGTGTGCTAGGCCACAAAGAATTCAGGTTTGTTCTTCCAGTGCTTCCT ATAGCTTTGATATTCTCTGGACATTCATTAGCTGCATTAAGAACAACGATTTCTGCCAAT GGTAAAGGGAAAGAATCATCAAATATCCATAGAACATGCCCTGCTAAAATGCAGGTGGCC ATCTTTTTCTTGCTCGCTACCAATATTCCAATGGCCCTGTATATGAGTTTGGTTCATCAG AGAGGAACTGAGGATGTTACATACTATCTATCCAAAGAAGTGCTTGATGGAAAAGTGACA AATATACTTTTCCTAATGCCTTGCCACGCCACACCTTACTACGCGACTGTGCACCACAAC CTTCCAATGAGATTCTTAGACTGCTCACCAAGAGAAGAGAAAGGAATCCCAGATGAATCG GACCATTTCATGATGGATCCTGTTGGTTTTGCATCAGAGTTTGCAAAAAATTGGTCTTTA CCCAGTCACATTGTATTATTTGATTCGGAAGAAAAACTGTTGAAGGATTTTCTAATCTCA CATTCTTTCAAAGAGATAAACAGGTTTTTCCATGCTCACTTCAAAGTGGACCGTGATCTT CAAGCGTCAGTTGTTGTGTATGGTTCCACCGGCGACTGA
PEP MRQRQNVAVSSAAETDRTQNPIPSKSDPQQKKAQSFDFLGSSKKVFALCFAFRIANALLV QTYFNPDEHWQALEVAHRITFGYGHLTWEWEKGIRSYLHPLLFALLYKLLAVLGLDTPWF MVRAPRLFQSFFSAFGDLYLYKLSVILFGHCVAKWAVSFCMRVTFNYYYSQTHYGKHLFV CGRLFSQLTNWFMFYCLTRTLSNSLETVLTLVSLYYWPCMRPSSSKLPLESRKWGLVIAA LACAIRPTSAIIWLYVGLLELFVTRDKLRFIFLEVAPMGLLVLGLTFLLDRLMYGSWVLV PLNFLKFNFLSAGGDYYGTHKWHWYFTQGFTVMIFSFLPFSVAGIMQSKHWKLSGLIAWV LGLYSVLGHKEFRFVLPVLPIALIFSGHSLAALRTTISANGKGKESSNIHRTCPAKMQVA IFFLLATNIPMALYMSLVHQRGTEDVTYYLSKEVLDGKVTNILFLMPCHATPYYATVHHN LPMRFLDCSPREEKGIPDESDHFMMDPVGFASEFAKNWSLPSHIVLFDSEEKLLKDFLIS HSFKEINRFFHAHFKVDRDLQASVVVYGSTGD


| Top |