Cherry SNP DataBase

Gene information

Gene Pav_sc0000764.1_g380.1.mk
Chromosome name PAV_r1.0chr1
start 5870320
end 5871604
PAV_r1.0 name Pav_sc0000764.1
start 215603
end 216887
direction +
Annotation NR PREDICTED: cinnamoyl-CoA reductase 2-like isoform X2
Sequence CDS ATGGTATGGAAGCCACAACTTGAAACGAAAACGAAAACTGAGAGAGCGCGAATGGACAAC GAAAAACCCATCGTTTGTGTTCTTGATGCTTCAACCTACGTGGGCTTCTGGATTCTCAAA GGATTGCTTGGTAGAGGTTTCACAGTCCACGCAGCCATCCAGAAGAATGGGGAAACAGAA ATTCAGAAGAGAATTAGGGAGATGGAGAAAGTAGAAGAGAGATTGGAAGTGTTTGTTGTG GATGTTTTGGACTACCATAGCATTCTTTTGGCTTTGAAGGGTTGCTCTGCTATGTTCTGC TGTTTAGACAGTTCAGATGGATATGATGAAAAAATGGTGGATTTGGAGGTGAGAGGAGCA ATTAATGTTGTGGAAGCATGTGCTCAGACAGAGACTGTGGAGAAGATTGTGTTCACTTCT TCTTTGACTGCAGCAATTTGGAGAGAGAACATTAGTTCTGAGAAGGATGTGGATGAGAAA TCATGGAGTGATCAGGAATTTTGCAGGAAATTGAAGTTGTGGTATGCCCTGGCAAAGACA CTCTCTGAGCAGGCTGCTTGGGCTTTATCCATGGACCGGATGCTCAAGATGGTGTCCATA AACTCTGGACTTGTCCTCGGGCCTAGTGTCGCTCAACAGAACCCTCGGACAACTATGTCT TATCTTAATGGTAATTAA
PEP MVWKPQLETKTKTERARMDNEKPIVCVLDASTYVGFWILKGLLGRGFTVHAAIQKNGETE IQKRIREMEKVEERLEVFVVDVLDYHSILLALKGCSAMFCCLDSSDGYDEKMVDLEVRGA INVVEACAQTETVEKIVFTSSLTAAIWRENISSEKDVDEKSWSDQEFCRKLKLWYALAKT LSEQAAWALSMDRMLKMVSINSGLVLGPSVAQQNPRTTMSYLNGN


| Top |