Cherry SNP DataBase

Gene information

Gene Pav_sc0000764.1_g420.1.mk
Chromosome name PAV_r1.0chr1
start 5890713
end 5895972
PAV_r1.0 name Pav_sc0000764.1
start 235996
end 241255
direction -
Annotation NR PREDICTED: putative clathrin assembly protein At5g35200
Sequence CDS ATGCAAAAAGGATCTACCACCTTCCCACCCCACCCCAATGCCATGCCACCAGAGCTCATG GTGGGCGGAGCAATAACTGCTGATGATGTTCATCATCCTGAGTTATGTGGAATGGCAGCA GGCAGCCCGCAAAGCTTAAGAAAAGCTTTGAAAACTGTTGGATTGGCAAAAGCCAATGGC GATTTCAAGGCACTGGATGTTGCCATTGCCAAGGCCACAAGTCATGATGAAGCATTGCCC AAGGAGAAACATGTTTTAACTATACTAAAGGCAGTTTCGGCTTTAAGACCTCGTGCTGAA GCCGCTTACTGCATCCATGGTCTTGCAAGGCGTCTTAGTAAGACTCACAATTGGAAGGTA GCACTGAAAACCGTGATTATTGTGCACCGTGCTTTGAGGGAAGTTGATGACACATTTTGT GACGCTGTAGTCAAATATAGCTGGAGTAGAGGTCATTTGCTGAATTTATCTCATGTTTGG GATGGATCAAGTTCAAGTGCATTGGATTTTTCTGCTTGGGTGCGGACGTATGCATCATAC CTTGAAGAGCGTCTGGAGTGTTTCCGCGTATTGAAGTATGATGTCCAGAAAGATCACTCG AGAACTAAGGAACTTGATACCCCAGACTTACTAAGGCAATTACCTGCCTTGCAACAGCTT CTCTCTCGCCTTCTTGATTGTCAGCCAAAGGAGGGAACTGTATGTAATTGCTTGATTCAG TTTGCCCTGTCAATGGTTGCAGGTGAAAGTGCCAAGTTGTATGCTGCAATTACTGATGGC AATGTCAATTTATTAGACAAGTTCTTTGAGATGCAGCACGATGATGCAGTTAGAGCACTC GAAATTTATAAGAAGTCGAGAAGCCAGGAAGAGAGGTTATGTGAGTTCTTTGAGATCTGC AGGAGCTTTAACTTTGGACGGGCGCTGAAATTCATCAAAATTCAACAGCCCCCTGCATCA TTCTTGACTACCATGGAAGATTATGCGAATGACGTTCCCAGCAGTTCAACACTTCAACAT ATGCAAATCAATGAGGAGGAAGATGCTGCTCTCCAGGGAATTCATCTGGTAGAAGGTGAT TTGTTAATTGACCATAAACAAGATGATAATGTAGAAGAAAAATCAAATGCCAATGGGACA GCCCCTGATCAGAGTGAGGCTGCTGGCACATCACAAGTGATTGATCTTCTGAGCTTTGAT GAATTGCCCCCAGTAACATCAGAGTCAAATGAGCAAAATTCTCTCGCACTTGCAATTGTT CAATCTGATTCCAAACCAGATGGTCTCAATTCAATAAGCTCGGAGTCTAGTTGGGAGCTT GCACTTTTTACAGCTCCAAGTTCTAATGCAGATGCAGTTTCAGCACCAAGTTCTAATGTA GCTTCAGCTGAAGAGACTAAGGTGGCTGTTGGACTGGACAGATTGACACTGGATAGTCTA TATGATGGTGCAATGGCAAGTACACCAAATCAGAATGGCTTCTACCACAGACAGGCACCC TCTAATCCTTTTGATGATGCCCCAATTAGTCCTTACCAATTAGTCCCACTTCCCCCAAAC AACATGCAAATGGCTATGATGCCCCAACAACATGTACAAGGCCAAGTCCCATTTTATGGT CTCTATAGCAATGCAATTCCAACAGCCCCAACTAACTCACAAATGCCTTTCGTGACCCAA CAAGAAGCTTTCATGATGCAGCAGCAACAGTTGGCCAACGTCAGTAATATTCCATCAAAT TCTTCTGGCAATCCCTTTGCTATTGAGCAGAGTTATTCGCAACTGCCTCCAAACTCTTTC AATGGCTTCATTTAG
PEP MQKGSTTFPPHPNAMPPELMVGGAITADDVHHPELCGMAAGSPQSLRKALKTVGLAKANG DFKALDVAIAKATSHDEALPKEKHVLTILKAVSALRPRAEAAYCIHGLARRLSKTHNWKV ALKTVIIVHRALREVDDTFCDAVVKYSWSRGHLLNLSHVWDGSSSSALDFSAWVRTYASY LEERLECFRVLKYDVQKDHSRTKELDTPDLLRQLPALQQLLSRLLDCQPKEGTVCNCLIQ FALSMVAGESAKLYAAITDGNVNLLDKFFEMQHDDAVRALEIYKKSRSQEERLCEFFEIC RSFNFGRALKFIKIQQPPASFLTTMEDYANDVPSSSTLQHMQINEEEDAALQGIHLVEGD LLIDHKQDDNVEEKSNANGTAPDQSEAAGTSQVIDLLSFDELPPVTSESNEQNSLALAIV QSDSKPDGLNSISSESSWELALFTAPSSNADAVSAPSSNVASAEETKVAVGLDRLTLDSL YDGAMASTPNQNGFYHRQAPSNPFDDAPISPYQLVPLPPNNMQMAMMPQQHVQGQVPFYG LYSNAIPTAPTNSQMPFVTQQEAFMMQQQQLANVSNIPSNSSGNPFAIEQSYSQLPPNSF NGFI


| Top |