Cherry SNP DataBase

Gene information

Gene Pav_sc0000773.1_g120.1.mk
Chromosome name PAV_r1.0chr2
start 5974610
end 5985397
PAV_r1.0 name Pav_sc0000773.1
start 101999
end 112786
direction -
Annotation NR PREDICTED: sister chromatid cohesion 1 protein 3
Sequence CDS ATGGCTACAATCTCATCCCTACTGTCACCACCCAATCTCCTTCACCATCCCACAAATCCC ATCAAAGCCGCACCAAAACTGTCTCTCCAAATCCTCAAACCAACCCAATTTCAGGGCTTT CACAAACTCACTTCCTCTTATATGATTCTGACCCCCAGACATTCACAAAGAGTCTTTGCT GTTGCCGAAGAAGTCGCAGCCGACCCGTCTTCTAAAGCGGCCAGGAGAGTTTACATTGGC AACATTCCCAGGACTGTGGATAATGCTGAGCTTACCAAAATTGTTGAAGAACACGGAGCT GTAGAGAAGGCTGAGGTGATGTTTGATAAGTACTCTGGAAGAAGTCGCCGATTTGCATTT GTTACAGCAAAGACTGTTGAAGATGCAAATTCCATTGTTGAAAAACTGAATGGAACTGTA AGTGTTGCCAAGGAGATTGGAGGACGTGAAATCAAAGTAAACATAACTGAGAAACCCCTG CTACAAGCGGACGTATCACTTCTTCAGGCAGAAGAGTCCCAATTCATTGACAGCCCCCAT AAAGTGTATGTTGGAAATCTTGGAAAGGAAGTAACTACGGATACACTCAAAACCCTCTTC TCTGAGAAGGGAAAAGTTCTTAGCGCAAAGGTTTCCCGGGTTCCAGGGACTTCAAAATCT AGTGGTTTTGGGTTTGTTTCTTTCTCCTTGGAGGAGGATGTAGAAGCTGCCATCTCATCT TTCAACAATACTACGTTCTTGGCTCGGAAGGGCCCACTGGGAACCGTATGGTGTGCGGCG CATCTGCAGAGCAGGTTAAAGAAGTCCCATTACACTTCCACCGACATCCCCTCCACCGTT GGTGCCGCCCGTCTAAGGATTGCCCCATCAACAGAATCATATACCCTTTTAGATATGCTT GGGTTCAAGTTACTTGATCGCATCATGTTTCCGGATGTTCCTATTGCACTGAGAATGTCA GGACACCTTCTAGTAGGTGTTGTTCGGATATACTCAAAGAAAGTCGACTATCTTTACCAG GACTGTACTGTTGTTTTGACTAGCCTAAGAAAGGCCTTTGCTTCTATAGACTTGAATTTG CCAGAGAATGCAAGACAAGCACCGGTCCAATCCATCACTTTGCCTGACACATTTGACCTT GATGCTTTGGATTTGGATACAGACTTGTTCTGTGAGGGGGCTCACGATAATCATCTCAGG AGTGAGGAAGACATCACACTAACAGATCAAATTCCTATTGGAACAAACCCTTATGTTGCT ATAACTTTTGACGAGGATATACAGATGTATCTATCACTTCCAAAAGAGGTTTTTGGTTCA GATGCTACCCCCATGGATGAGGACATCCTCCATACACCTCCAGCTGAGGGGGCTCCTAGT CCAGGCAATCAGACAGATGAACAAATAAGATTTAGTGATGACTTCACCCTTCCAAATTTT CCAGAAGTTGAGGTTCCACAACATGTTGGTTTTGAAGATACTGTTCCAACTAACCAGAGA GAAAGTATTGATTTGAGGCATAGAGATGACGGTTCCCCTGAACATGTTCAAGAAATGGAA GTTCTGCGAGATGCTGTTTCTGATTTTAGCTCAGAAATCCTTCCTCCGGTTTCCCCCAAT AACAGTGATGATGTAACTGAACCATACAGGTCTGTTGACCCTGAAAGGAGTGAGAAAGAC ATTCTTTCTCCAATTATGGAGGAAACTATACCTTCTGGTGGGCCATCTCCATTATTTCAG CCAAGTTCAGGACCACCAGCATCTGTTGCTTCTTTGCCAGAGGGTCTACAAAATATTGAT ACACATGTTTCATTTGAACTTCAACCAACACCACCTCCTGAGCAGCCAAGAGCAAGACCA AGGAAGAGAAAGCAGTATTTTGATGAGACCCTTGTGTTGTCCAATGAGTTTATGAATAAG ACAATTCAAGATACTAGTGATTTATTGCGTAAAAGGAGGAATATTCCGTGCTCTGCTTTG GGTGTTTGGAAGTTGAACAACAGTTTAAGAAAGGAACAAATATTCTTCCAGCCTTCATTA AGTGGTCTGTGTTCAGATCTTTGTAACATTTCCAACAAAGACTATATATCCACAAAATCC CATTTGTTTGAGGAAGCTCTTCCAGACTCTAGGCCTACAAGATCTCCTTCTCCCACAACT GAAGCTTTCTCAGAAGCTAGGGTTGCACAATCTCCTCGTCCTTTTACAACTGAAATCTCC CCAGAGCGTAGGGTTGCACGGTCTCTTCCTGTAACTGAAGCTTCCATAGAGTATAGGGGT GCACAATCGCCTGCTACTCAATGCAACCCAGAAATTGATCAACTCAGACATGTTGAAGAA CATGATGGGGAAAATATCTTACCTGAGTTTATACCTTCACCAAGATTCATGCCTTCTCCC AGGAGAGATGATCTTACGCCTGCTCCATCTCCATACTTACGGTCAGCTTCAGTTCCTCCA TTGGAAACAAGCACTGGAACACAAATACTGCAGACACCAGACCTACCATCATCAATTGGA TTTCATGAGACTGTTTTTGAAACTCCAAGGACAATATTTGAGGAGCAGTTACGTCCAGAA AACACTGGTCTATCAGATACTCCTGACTTAAGGAATACTGCAGAAGCTGAAGATCTTTAT TTTCTGGAAGCAGATAGCAGTACACCAGCTGGTAAACTCAGAAACCTTTGCTTGATCAGT GATTTGGATGATTCTGATCTCAAGGGACACAAGGAGTACCAGGATCTCAAGGGACACACG CAGTTGATTCATTGTCTGTTAGAACCAGGCGTTGCCAGGTCAAAGCATGAGGAAGGGAAT GATGCAGTGTTAGTTTGTAAACAAGTTAAGTTGCAACGGAATTTTTGA
PEP MATISSLLSPPNLLHHPTNPIKAAPKLSLQILKPTQFQGFHKLTSSYMILTPRHSQRVFA VAEEVAADPSSKAARRVYIGNIPRTVDNAELTKIVEEHGAVEKAEVMFDKYSGRSRRFAF VTAKTVEDANSIVEKLNGTVSVAKEIGGREIKVNITEKPLLQADVSLLQAEESQFIDSPH KVYVGNLGKEVTTDTLKTLFSEKGKVLSAKVSRVPGTSKSSGFGFVSFSLEEDVEAAISS FNNTTFLARKGPLGTVWCAAHLQSRLKKSHYTSTDIPSTVGAARLRIAPSTESYTLLDML GFKLLDRIMFPDVPIALRMSGHLLVGVVRIYSKKVDYLYQDCTVVLTSLRKAFASIDLNL PENARQAPVQSITLPDTFDLDALDLDTDLFCEGAHDNHLRSEEDITLTDQIPIGTNPYVA ITFDEDIQMYLSLPKEVFGSDATPMDEDILHTPPAEGAPSPGNQTDEQIRFSDDFTLPNF PEVEVPQHVGFEDTVPTNQRESIDLRHRDDGSPEHVQEMEVLRDAVSDFSSEILPPVSPN NSDDVTEPYRSVDPERSEKDILSPIMEETIPSGGPSPLFQPSSGPPASVASLPEGLQNID THVSFELQPTPPPEQPRARPRKRKQYFDETLVLSNEFMNKTIQDTSDLLRKRRNIPCSAL GVWKLNNSLRKEQIFFQPSLSGLCSDLCNISNKDYISTKSHLFEEALPDSRPTRSPSPTT EAFSEARVAQSPRPFTTEISPERRVARSLPVTEASIEYRGAQSPATQCNPEIDQLRHVEE HDGENILPEFIPSPRFMPSPRRDDLTPAPSPYLRSASVPPLETSTGTQILQTPDLPSSIG FHETVFETPRTIFEEQLRPENTGLSDTPDLRNTAEAEDLYFLEADSSTPAGKLRNLCLIS DLDDSDLKGHKEYQDLKGHTQLIHCLLEPGVARSKHEEGNDAVLVCKQVKLQRNF


| Top |