Cherry SNP DataBase

Gene information

Gene Pav_sc0000773.1_g160.1.mk
Chromosome name PAV_r1.0chr2
start 5943666
end 5956736
PAV_r1.0 name Pav_sc0000773.1
start 130660
end 143730
direction -
Annotation NR PREDICTED: clustered mitochondria protein
Sequence CDS ATGTTTCTCATATTAGCCTTTTTTTTTTGGTATTGGATTAAGGTCCAAGCTGCAGAGAAA CCAAAATGTAAGTCAAGTGAGGGAGAAGGTCACGTCACCAATGATTCTCCAAACATCACC GATGTTAAAGAGGACATAACAGGAGAAGGGAAGGACACAGATGCAGAAGGTGCTTCTCCA CCCACCGACAACTCTGAATCATGCAAGGAATCTCTTTCCAACCCTGATGCCTTAACTGAG TTTAAGGTGGCTGGAAGTGAGGAGGACATAACAGAAAAAGGGAAGGCCACAGATGCACAA GAAGGTGCTTCCCCACCCACGGACAGCGCTGAATCATGCGAGGACATTCTTTTCAACCCT AATGTCTTCACTGAGTTTAAGTTGGCGGGAAGTGAGGAGGAGATTGAAGCAGACGAAGGA AATGTGAGGAAAGCCAGTTTGTATCTTACAGATGTTGTGCTTCCGAAGTTTATACAAGAC CTTTGCACACTTGAAGTATCACCCATGGATGGGCAAACACTAACTGAAGCACTCCATGCT CATGGAATTAATGTTCGCTATATTGGGAAAGTGGCTGATGGGACCAGACATTTACCTCAT CTCTGGGATCTTTGCTCTAATGAGATTGTGGTGAGATCAGCAAAGCACATTCTCAAGGAT GCCTTGAGAGAAACGGATGATCATGATATTGGGCCTGCAATCTCCCATTTCTTCAACTGT TTTTTTGGAAGCAGTCAAGCTGTTAGCTCTAAAGTGGCTGCTAATAGTGTGCAGTCTAGA ACCCCCAAAAAAGAACAAACAGGCCATCAATCTTCAGGAAAGCTGTCCAAGGGACAAGGA AGATGGAAGGATGGAGCATCTACAAGAAAAAATCAATCCTCATTTATGCATGTTAGCTCA GAAACTCTATGGTCTGACATTCAAGAATTTGCAAAGCTCAAATATCAGTTTGAGCTGCCA GAGGATGCTAGGACTCATGTAAAGAAAGATTCTGTTATACGTAATCTTTGTCAGAAGGTG GGCATTACAATTGCAGCTCGCAGATATGATCTTAATTCTGCAGCACCTTTCCAAATATCA GATATCTTAAATCTGCAACCTGTAGTGAAACACTCAGTTCCTGTGTGTTCAGAAGCTAAG GATCTTGTGGAAACAGGAAAGATCCAACTGGCAGAGGTTACTGGTCCAATGCATCGGGAG GTTGCAAACTGCTGTCGGTATCTTGCCATGGTCCTTTATCATGCAGGAGATATGGCGGGA GCCATAATGCAACAACACAAGGAACTAATTATAAACGAGCGTTGCCTGGGTTTAGACCAC CCTGACACTGCTCACAGGTATTGGGTTCTTGTGTTTATTTTTGTTTCATTAACTGAGATG GTTGTTGAATACTTATTCTGA
PEP MFLILAFFFWYWIKVQAAEKPKCKSSEGEGHVTNDSPNITDVKEDITGEGKDTDAEGASP PTDNSESCKESLSNPDALTEFKVAGSEEDITEKGKATDAQEGASPPTDSAESCEDILFNP NVFTEFKLAGSEEEIEADEGNVRKASLYLTDVVLPKFIQDLCTLEVSPMDGQTLTEALHA HGINVRYIGKVADGTRHLPHLWDLCSNEIVVRSAKHILKDALRETDDHDIGPAISHFFNC FFGSSQAVSSKVAANSVQSRTPKKEQTGHQSSGKLSKGQGRWKDGASTRKNQSSFMHVSS ETLWSDIQEFAKLKYQFELPEDARTHVKKDSVIRNLCQKVGITIAARRYDLNSAAPFQIS DILNLQPVVKHSVPVCSEAKDLVETGKIQLAEVTGPMHREVANCCRYLAMVLYHAGDMAG AIMQQHKELIINERCLGLDHPDTAHRYWVLVFIFVSLTEMVVEYLF


| Top |