Cherry SNP DataBase

Gene information

Gene Pav_sc0000780.1_g170.1.mk
Chromosome name PAV_r1.0chr6
start 17490041
end 17499564
PAV_r1.0 name Pav_sc0000780.1
start 91957
end 101480
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103339820
Sequence CDS ATGGAAGAAGAGGCGGTTTGTTTGGGCCAATTAACAGATGGGGGAGTGGAAACTGACGAC TTCCCAAGAACTGAATTGAAGCGAGACCATCAGTGTGTCGTAGATGATACCGAGCCAGAC TCATTTCCAAACAAGAAGCAAGCCAAAGAGCATTCCAATGAGGATATACGCTCGGAAGTT TCAAACCCGGTTGTCTCTCCAAAAGAGAACGCCTCCACTTTTCAGGACATAACTAGCCAA CCGGCTGAAGTGGAAAATAGTAACCAAGTTGAGTGCGGTGAAGTCACTTCCCCGTGTTTG GGGAATTCAAGCTCAGGGGAGACCTTGAGCGATGGACAGCGTGCTGGGAATGATAATTCC CGAATTGATAACGATACGAATGGTGATGTATTGACTTCTCGTGTTGTAGTTGAAATTCCT AAGCTTGCCAGTTCATCTGGGATTCGCAAAATTACGTTTAAGTTCAGCAAAAAAAAGGAG GATTATGTCAGTCAGTCAGGGGCTTCAATTAGTCAGACTGTGAGTAATGGACTTGGCAGT GGCTTTACACATGGAGGTTCTTATGAGGATCCTGGAACAGACTTTCAAGCAATGGCTAGT ACAAGTAGGGAGTTTCCTGCAAGTTCATATTCGAGGAAGTACGCTGAAACCGGAAATTGT CATCCATGTACTCCTAATAGGGAATTGGAAGCGTCTAACAAGGTTTCGAGCAGCTATCCT ACAAATGTCAAAAAGCTATTATCTACTGGTATTCTTGATGGAGCTAGAGTGAAATATGTT TCCACCACATCAGAGGTACTCAGTGCATATGAGTTTGAGCAGCACGCTGGTGTTAAGACT CGCCATCCTAATAATCATATATACTTGGAGAATGGGAGGCCAGTTTATAGTATCATACAA GAATTGAAGACTGCTCCACTAGACTCGCTGGATGAAGTGATAAGGGGTGTTGCTGGTTCT TCTGTCAATGAAGAGTCCTTCCGTGTTTGGAAAGCAACCCTTCATCGAAGTGATGGAATG GCTGAAGTAGATAAAAGACCTTGTGTGAAGCTTCCTAAACTGCCTCATTCGCTTCCTAAA CTGCCTCATTCGCTTCCTAGGCTGACTCATTCTCTTCCCAGACCAAGCTCTCACACACCT TACTCAGTTATATACCAGAAGAAACCTGCTGAAGGTGGCAATAAGAGAAGGGATAATGAT CTTCACCGGTTACTGTTTATGCCAAATGGGCTTCCAGATGGAGCTAAATTGGCATACTAT GTCAAAGGCCAGAGATTACTTGGTGGCTATAAGCAAGGAAATGGTATAGTCTGTAATTGC TGTGACAGAGAGATAAGCCCTTCACAGTTTGAAGCTCATGCTGGAATGGCTGCAAGGCGT CAACCCTACCGTCACATCTATATTTCCAATGGATTGACGCTTCACGATATAGCCATGTCC TTGGCCAATGGGCAAAACCTCACCATTGGTGGCAGTGATGGAAATGATGATATGTGTGCA GTTTGTGGACATGATATGGGGGATATGATTTTTTGTGATGGTTGCCCTCGTGCTTATCAT TCAGCTTGTTTGGATTTACCGTGGGTTCCTGAAGGTGATTGGCATTGTCCAAATTGTAGA GATAAATTTGAACCTGGTAGGAAAGCTGCTGGTGGGGAATCTTCAAATTTTGGAAAACCA ATTGTAATACGGTTGACAAGGGTCTTTAAAGCCCCTGAATTTGAAATTGGTGGTTGTGTT GTTTGCAGGAGCCATGATTTCAGTGCGGCTTTATTTGATGACCGAACAGTTATAATCTGT GACCAATGCGAGAAGGAGTTCCATGTCGGTTGCTTACGGAACAGTGGATTATGTGACTTA AAAGAACTCCCCAAGGATAAGTGGTTTTGTTGTGATGACTGTACTAAGATTCATGCAGCA TTGCAGAATTTAGTATATAACGGAGCGGAGCGGATTCCAGCTCCATTGTCAGACACAATA ATCAGGAAGCATGCAGATAGAGGTATATTTATTGATGGAGTGACAGATGATGTTCAATGG CGAGTTTTCAGTGGTAAAAGTCGCTACCCAGAACATCTACCCTTTCTTTCAAGGGCTGCT GCAATTTTTCGGGAGTGCTTTGACCCTATTGTTGCACAATCTGGTCGCGATTTGATCCCT GTTATGGTTTATGGGAGAAATATATCGGGCCAAGAGTTTGGAGGCATGTATTGTGTAGTT TTAATAGTGAGGTCTGTTGTTGTATCTGCTGGTCTCCTTAGGGTTTTTGGTAGGGAGGTT GCTGAGCTTCCTATTGTCGCTACAAGTAGAGAACATCAAGGAAAAGGTTATTTCCAAGCA TTATTTTCGTGTATAGAGAGGTTACTTATTTCCCTGAAAGTGGAAAAGCTGGTTCTCCCT GCGGCTGAGGAAGCCGAGTCAATCTGGACGAAGAAATTAGGCTTTAGAAAGATGAGAGAC GAGCAAGGGTACGTCAATGCTGGAAAAGGTGGTGGAGTTGATGGATTGACCGCTCGTCGA TTTTCCGATAGTTTCCACTCAGAGAAGTTAGTCGGATCATATCAAATGGCGTTCATCTCT AGCTTCCGACGCGTTCTTGGCGGATCTTCCTCTGCTATTCAATCCCAATTCGTCGCCATT CGTCACAATTCAACTCTCACTTCCCCCAAGCTATTCATCAGCGGTCTTTCCAGACTAACA ACAGATGAAAAGCTTCAAGAGGCATTTTCTCCATTTGGGCAGATTGTAGATGCGAAAGTG GTTATCGATAGGGCGTCGGGAAGATCAAAGGGGTTTGGTTTCATCACATACACGTCCATT GAAGAGGCCGAGCAAGCTAGAGAGGGAATGAATGCCAAGTTCTTAGATGGGTGGGTTATT TTCGTTGACCCTGCGAAACCTAGGGAGCCTAGGCCTCCACCTCAAGCACAGCCAAATCCT TCTGAAACTGCGGGTCCTAACTCTTGTGAGTTGGCCCTTATGTCTGAAGCTGAAGCGGCT CTATCTGGTTTGAAGTTGGCTGCACAGTTTGGGCATCAGAGAGTAATCTTGGAATCTGAT TCCAAAGTTTTAGTTGAAGGTTTAAATGGCAAGTTGGGTAATAGAGCATGGACTATCTTG CCTATTATTAAGGGCATTAGGAAGTTGGCGGCTTCCTTTGTTTCCTGTGAGTGGTTTTGG GCTCCTAGAAGCCAAAATATGGCTGCTCATGAAGCTGCAAAGCTTGGTAGAGGTCTGGTG GAAGAGCGATGCTGGCTCAATAGAGCTCCACTTGCTCTCATGCACGTTCTCAATTCTGAT GGTCTACTTGGTCCACCTTAG
PEP MEEEAVCLGQLTDGGVETDDFPRTELKRDHQCVVDDTEPDSFPNKKQAKEHSNEDIRSEV SNPVVSPKENASTFQDITSQPAEVENSNQVECGEVTSPCLGNSSSGETLSDGQRAGNDNS RIDNDTNGDVLTSRVVVEIPKLASSSGIRKITFKFSKKKEDYVSQSGASISQTVSNGLGS GFTHGGSYEDPGTDFQAMASTSREFPASSYSRKYAETGNCHPCTPNRELEASNKVSSSYP TNVKKLLSTGILDGARVKYVSTTSEVLSAYEFEQHAGVKTRHPNNHIYLENGRPVYSIIQ ELKTAPLDSLDEVIRGVAGSSVNEESFRVWKATLHRSDGMAEVDKRPCVKLPKLPHSLPK LPHSLPRLTHSLPRPSSHTPYSVIYQKKPAEGGNKRRDNDLHRLLFMPNGLPDGAKLAYY VKGQRLLGGYKQGNGIVCNCCDREISPSQFEAHAGMAARRQPYRHIYISNGLTLHDIAMS LANGQNLTIGGSDGNDDMCAVCGHDMGDMIFCDGCPRAYHSACLDLPWVPEGDWHCPNCR DKFEPGRKAAGGESSNFGKPIVIRLTRVFKAPEFEIGGCVVCRSHDFSAALFDDRTVIIC DQCEKEFHVGCLRNSGLCDLKELPKDKWFCCDDCTKIHAALQNLVYNGAERIPAPLSDTI IRKHADRGIFIDGVTDDVQWRVFSGKSRYPEHLPFLSRAAAIFRECFDPIVAQSGRDLIP VMVYGRNISGQEFGGMYCVVLIVRSVVVSAGLLRVFGREVAELPIVATSREHQGKGYFQA LFSCIERLLISLKVEKLVLPAAEEAESIWTKKLGFRKMRDEQGYVNAGKGGGVDGLTARR FSDSFHSEKLVGSYQMAFISSFRRVLGGSSSAIQSQFVAIRHNSTLTSPKLFISGLSRLT TDEKLQEAFSPFGQIVDAKVVIDRASGRSKGFGFITYTSIEEAEQAREGMNAKFLDGWVI FVDPAKPREPRPPPQAQPNPSETAGPNSCELALMSEAEAALSGLKLAAQFGHQRVILESD SKVLVEGLNGKLGNRAWTILPIIKGIRKLAASFVSCEWFWAPRSQNMAAHEAAKLGRGLV EERCWLNRAPLALMHVLNSDGLLGPP


| Top |