Cherry SNP DataBase

Gene information

Gene Pav_sc0000789.1_g290.1.mk
Chromosome name PAV_r1.0chr2
start 19215661
end 19254743
PAV_r1.0 name Pav_sc0000789.1
start 117062
end 156144
direction +
Annotation NR PREDICTED: adenylate kinase-like
Sequence CDS ATGGCGGTTTTGAACCGCGTTTTAAGATTAAGAGCAGCAAGCTCTTTCTCAGTTCGGAGC TTCCGTTCATCATCTTTTCTAAATTCCGAAACTGACATCAAGGCGTCTTCCTCTGTCATC ACCCAAAAGTCTCTTCCTCTGCAGCGAGACGTTAAGGACAGGAATGCCCAGTGGGTCTTC CTCGGCTGCCCCGGCGTCGGCAAAGGCACCTACGCCTCTCGCCTCTCCACCCTCCTCGGC GTCCCCCACATCGCCACGGGCGATCTCGTTCGCGACGAGCTCTCGTCTTCTGGTCCCTTC GCTCTTCAGCTTGCAGAGGTTGTGAACCAGGGCAAATTGGTTTCGGATGAGATTATCATA AACTTGTTGTCCAAGCGTCTTGAAGCTAGTGCAGCTAAGGGTGAAACTGGCTTCATTCTC GACGGTTTTCCTCGAACTATTCGTCAGGCGGTAATACCATTATTTTTTCCATCAAAATTT TGCTTGAAACATACATTGGATGATCTTGCTTGGGAGATAGCAAATAGGGACAATATGATC TTGCAGGTGTAG
PEP MAVLNRVLRLRAASSFSVRSFRSSSFLNSETDIKASSSVITQKSLPLQRDVKDRNAQWVF LGCPGVGKGTYASRLSTLLGVPHIATGDLVRDELSSSGPFALQLAEVVNQGKLVSDEIII NLLSKRLEASAAKGETGFILDGFPRTIRQAVIPLFFPSKFCLKHTLDDLAWEIANRDNMI LQV


| Top |