Cherry SNP DataBase

Gene information

Gene Pav_sc0000789.1_g460.1.mk
Chromosome name PAV_r1.0chr2
start 19364178
end 19366517
PAV_r1.0 name Pav_sc0000789.1
start 265579
end 267918
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103332448
Sequence CDS ATGGATGAACAAGTTTTGATAGAAATCTCAAAGCATCTTAAGCCCAAGAGGTATACTAAT CAAATCATTATTAAAGAGGATCGACCACTTGAAATGATGCTTTTTGTCGTGGAAGGACAT GTAATCATTAAAAAGAAAGATTGTTCCAGTGAGTTCCAACTAGGTGCCGGAGATCTGTAT GGAGAGAAACTTCTAGTTTGGCCATCATGGACGTCCTTCCATGGGACAAGACCTATAGCA ACCGAGTCTGTTCAGGCCATTGATGATGTTGAAGCCCTTGTTCTCTTGGCCAGCGACATG GTCAGTATAGGCTCTAGATTCAGGTCAGATTTCAATAAGTTGGGGATGAGTGATCGAACG GATTCGCATTGGGAGCTTTTGACTTGTGACAAGGTGACTATGCTACAAGAAGTGCCGAAG CTTCGAAACATGGATAAACAAGTGTTGAAAGCAATGTCTGAACATCTTCAATCGAACGTC TATGGACACAACGTCAACATTGTTCAAGAGTACCGACCACTTAGCATGATGTTCTTCGTC ACGAGGGGAAAGGTAATAAATGATGAGACCGGTCGTGCAGGATATTTTTTTGGAGAAGAA CTTGTTGAGTGGGTACTGGATAAGTCTTTTCCTGAGATACTACCCTTGTCGACCTGTACT GCTAAAGTAGTCTCAAACGATGCTGAATTCCTCGTTCTAACTGCAGAAGTCTTGAAGAGT TTAGCCTCTGATAACTTCGTGTCACATTTCAGCAAGATCGCCTCTCCGCTAGATCTTTTT ACTTTTGTTCGGTTGACTAGGCTAAAGAAAGTGGAAATATTTCGACATATGGACAAACAA GTGTTGGAAGCAATTTCTGAGCGTCTTGATGTCGTGAACTACCCTTTTAAAAACACCTAT ATTATTCGAGAGAACGAACCACTTAAAATGATGTTCTTCGTCGTGCGGGGAGTTGTAACT ATTGAAAACAACCGTATTATTGAAAGGCCAAAAACCTGTGAAATGGGAGGTTTTTATGGA GAAGAACTTGCACATTGGGTTACAACTTGGGTATCACATAGCTCCTTTCCTGCCAAACTA CCTTTGTCAACTGGTTCTGCGCTACGCGGCCCCCGTGGTGGTCCTGTTGAAATCCTTGCT CTCAGTGCCGACGACTTGAAGAGTGTAGTCTCAAAATTCAGATCGAGTTTCACCAGGGAG AGCACCCTCCTTACATATTCTCAGTCAGAGCCTTCGACTCGGGACCCATTGACTATGCTA AAGAATGTGGAAAGACTTAAGACTATGGATGAGAAAGTGTTGAAAGAAATATGTGGGCAT CTTGAGCTCAAAAAGTACGAAGATGAGGACATTATTCAACTAAATGAACCAATGGAAATG ATGTTCTTCATCGTGAGGGGAGTTGTTGCGGTGACAAACGAGTACTGGAAACATTACCGC AATGAAGCAGAACGTTCAAATCACAGTGGAGACGACCTTATAGAATATTGGGCGCGATCT AAATATACCGTCTTTTCTGCCGAGTTGCCCTTATCTCCTTTTAGTTTTCGGGCCATTGGT GAAGTTGAAGTTCTGGTTCTTATGGCCAACGACTTGGCTAAGGTTCAGCCTTGTCGAAGT GTAACTATAATCGATTATTCAATTATTCAAGTTGATTAG
PEP MDEQVLIEISKHLKPKRYTNQIIIKEDRPLEMMLFVVEGHVIIKKKDCSSEFQLGAGDLY GEKLLVWPSWTSFHGTRPIATESVQAIDDVEALVLLASDMVSIGSRFRSDFNKLGMSDRT DSHWELLTCDKVTMLQEVPKLRNMDKQVLKAMSEHLQSNVYGHNVNIVQEYRPLSMMFFV TRGKVINDETGRAGYFFGEELVEWVLDKSFPEILPLSTCTAKVVSNDAEFLVLTAEVLKS LASDNFVSHFSKIASPLDLFTFVRLTRLKKVEIFRHMDKQVLEAISERLDVVNYPFKNTY IIRENEPLKMMFFVVRGVVTIENNRIIERPKTCEMGGFYGEELAHWVTTWVSHSSFPAKL PLSTGSALRGPRGGPVEILALSADDLKSVVSKFRSSFTRESTLLTYSQSEPSTRDPLTML KNVERLKTMDEKVLKEICGHLELKKYEDEDIIQLNEPMEMMFFIVRGVVAVTNEYWKHYR NEAERSNHSGDDLIEYWARSKYTVFSAELPLSPFSFRAIGEVEVLVLMANDLAKVQPCRS VTIIDYSIIQVD


| Top |