Cherry SNP DataBase

Gene information

Gene Pav_sc0000793.1_g130.1.mk
Chromosome name PAV_r1.0chr2
start 2095477
end 2101192
PAV_r1.0 name Pav_sc0000793.1
start 72054
end 77769
direction +
Annotation NR hypothetical protein CICLE_v10001569mg
Sequence CDS ATGATTGGGAGGAAGAACATGGGACGAGCTTCACCCTTACTTCTGGTTCTTTTGGCTCTT GGGTTTTTCTTTGCCACTTATAATTTTTTAACTATGATAATCCACTATAGATCTGTTGGG AAGTGGGTAGGTGATAATTCGAATGGTGGGTTACTGTCTGACCCCATTATTGGGATGCCT GAGGATGTGAAGAAATTCAAGAATTCCAAGTCACCATTCCATGTTGCCTTAACAGCCACC GATGCTCCTTACAGCAAATGGCAGTGTCGCATTATGTACTATTGGTATAAGAAGAATAAG GACTTGCCTGGATCGGAGATGGGAGGTTTTACCCGAATTTTGCATTCAGGAAATCCTGAC AACTTGATGGATGAGATCCCAACTATGGTCGTTGATCCTCTTCCTGCAGGTCTTGATCGG GGATATATTGTCTTAAACAGACCATGGGCTTTTGTTCAATGGCTGGAAAAAGCTACAATT GAGGAAGAATATATTTTGATGGCAGAGCCTGATCACATTTTTATAAATCCTCTTCCTAAT TTGGCTCATGGAGGATATCCAGCTGGCTTCCCATTTTTCTACATTAAACCTTCGCAGAAT GAGAAGATCATAAGAAAGTTTTATCCTGAGGAGAATGGCCCAGTCACAAATGTTGATCCA ATTGGCAATTCTCCTGTAATTATCAGAAAGGATTTACTGGAAAAGATTGCTCCGACATGG ATGAATGTTTCTTTGAGAATGAAAGAAGACACAGAGACGGATAAAGCTTTCGGATGGGTG CTAGAAATGTATGCATATGCTGTAGCATCTGCTTTGCATGGAGTGCAGCATGTTCTTCGG AAGGACTTCATGCTGCAGCCCCCATGGGATTTGGAAATTGGTAAAAAGTTTATTATTCAT TATACTTACGGGTGTGACTACAACTTAAAGGGTGAGCTAACATACGGCAAAATCGGGGAG TGGAGATTTGACAAGAGATCATATCTACGTGGACCTCCACCGAGAAACCTTCCCTTACCC CCTCCCGGGGTTCCTGAGAGTGTGGTCACCCTTGTAAAGATGGTGAATGAAGCTACTGCT AACATACCTAATTGGGACACACAATAG
PEP MIGRKNMGRASPLLLVLLALGFFFATYNFLTMIIHYRSVGKWVGDNSNGGLLSDPIIGMP EDVKKFKNSKSPFHVALTATDAPYSKWQCRIMYYWYKKNKDLPGSEMGGFTRILHSGNPD NLMDEIPTMVVDPLPAGLDRGYIVLNRPWAFVQWLEKATIEEEYILMAEPDHIFINPLPN LAHGGYPAGFPFFYIKPSQNEKIIRKFYPEENGPVTNVDPIGNSPVIIRKDLLEKIAPTW MNVSLRMKEDTETDKAFGWVLEMYAYAVASALHGVQHVLRKDFMLQPPWDLEIGKKFIIH YTYGCDYNLKGELTYGKIGEWRFDKRSYLRGPPPRNLPLPPPGVPESVVTLVKMVNEATA NIPNWDTQ


| Top |