Cherry SNP DataBase

Gene information

Gene Pav_sc0000793.1_g140.1.mk
Chromosome name PAV_r1.0chr2
start 2103097
end 2111939
PAV_r1.0 name Pav_sc0000793.1
start 79674
end 88516
direction -
Annotation NR PREDICTED: LOW QUALITY PROTEIN: lon protease homolog 1, mitochondrial-like
Sequence CDS ATGCTGAAGCTTCTCTCGTCTTCCTCGTCGTCATCCCTTCATGGCCGGCTCCACAGCCTC CGCCCCGGGCCCACCGAGCTGGCCTCGCCGGTTCTCCGTGTTCTCGGCTCGCTCACTGGG TTGACTTGGCCGAGCCCTAACTCGGCTCGCCGAGCCTTTTTTTGCTCGGATGGCAGCGAC GGGTCTGATCAGGTGGTGGAAATTGAGTTCAAGGGGGCGGGGGCTGAGGCCGAGGCCGAA GCAGAGTCCAAGTCTTCGTCAGCCATTGTGTCCACCAATCCTAGACCCGAAGACTATCTT ACGGTTTTAGCTTTGCCATTGCCGCATAGACCACTCTTTCCTGGGTTCTACATGCCAATT TATGTGAAGGATCCTAAATTGTTAGCAGCTTTACAAGAAAGTCGAAAGCGACAAGCTCCT TATGCAGGTGCATTTCTTCTCAAGGATGAACCGGGGACTGATCCTAGTTTGGTGTCAGGT TCTGAAACAGATAAAAACATACATGACTTGAAAGGAAAAGAGTTGTTCAATCGTCTGCAT GAAGTTGGCACGCTTGCCCAGATTTCAAGCATCCAAGGAGACCAAGTAGTCCTTATTGGT CATAGAAGACTTCGAATTACAGAGATGGATAAACCATATAACAAAGATGATGATGTCATA AAGGCAACATCATTTGAGGTTATATCAACCTTAAGAGATGTCCTCAAGACTAGTTCCCTT TGGAGAGATCATGTTCAAACATACACTCAGCATATAGGTGATTTTAATTTTCCAAGGTTA GCAGATTTTGGAGCTGCAATATCTGGTGCAAACAAATTGCAATGCCAGAAAGTGCTTGAA GAGTTAGATGTGTATAAACGTTTAAAGCTCACTCTAGAATTAGTGAAGAAAGAGATAGAA ATCAGCAAGATTCAGGAGTCTATTGCAAAAGCAATTGAAGAGAAGATAAGTGGCGAACAG CGTCGATACTTGTTGAATGAACAGCTTAAAGCCATAAAGAAGGAACTGGGATTAGAGACA GATGACAAAACAGCACTTTCCGAAAAGTTTAGGGAGAGGCTTGAACCAAACAGGGAAAAC TGCCCACCTCATGTTTTGCAAGTTATAGAAGAAGAACTTACAAAACTGCAGCTGTTGGAG GCCAGTTCAAGTGAATTTAATGTGACACGCAATTACCTAGATTGGTTGACTTCAATTCCC TGGGGAAACTACAGTGATGAGAACTTTGATGTTCTTCGGGCGCAAAAAATTCTTGATGAA GATCATTATGGATTAAATGATGTAAAGGAAAGGATATTGGAATTTATTGCAGTTGGAAAA CTCAGAGGAATCTCACAAGGGAAAATCATCTGTCTCTCTGGCCCACCTGGAGTGGGCAAA ACCAGCATTGGTCGTTCAATTGCACGTGCCTTGAACCGTAACTTCTTTCGGTTTTCTGTA GGAGGGTTGTCTGATGTTGCTGAAATTAAGGGGCATCGCCGAACCTATATTGGTGCTATG CCAGGGAAGATGGTTCAATGCCTTAAAAATGTGGGAACAGCCAACCCTTTAGTTCTGATT GATGAGATTGACAAGTTGGGAAGGGGACATGCTGGTGATCCAGCAAGTGCTTTGTTAGAG CTTCTTGATCCGGAGCAAAATGCTAATTTTCTAGACCATTATCTTGATGTTCCAATCGAC CTGTCAAAGGTTCTCTTTGTTTGTACAGCAAATGTTGTGGAGATGATACCTAATCCCCTC TTGGATAGAATGGAGGTGATTTCCATCGCTGGATATATCACTGATGAGAAAATGCACATT GCTAGGGACTATTTGGAGAAGACCACACGTGAAGCTTGTGGAATTAAACCTGAACAGGTT GAAGTGACCGATGCAGCTCTTCTCGCTCTCATTGAAAATTATTGCCGAGAAGCAGGTGTT AGGAACCTCCAAAAGCACATAGAGAAGATCTACCGCAAGATAGCTCTGCAACTTGTTAGA CAAGGAGCATCAGATGAAGCAGCAGTTGCTGATCAAATACAATCTCTCCCAGGTAGGCCT GCAGCTGTTGAAGTTCAGCTTGTAGATACTGATGAAGCCCAAGTAGAAGATGTTGATAAG TTAGATCAAAACGTGGTTTCTAGCAAGAACCAGACTGCAGCTGAATCATTGGACGGCAAT GATCATGATCATAGTTCTGAAACCTCTGCAGAAGAAGTCACTATTCAGATGGATCTCCCT GATGAACCTGCAGTTGTTGAAGTTCAGGTTGCAGATACTGATGAACCTGTGGATTCAAAG GATGCAAAAGAAACTGCGAAAATTCAGGAGGGTGGAGCAACAAAAACAGTTGAGAAAGTT TTGGTTGACTCATCAAACTTGGCTGATTTCGTTGGCAAACCTGTCTTCCATGCTGAACGC ATCTATGATCAGACTCCAATTGGAGTTGTTATGGGTCTTGCTTGGACTGCCATGGGTGGC TCCACCTTGTATATAGAAACCACTCAGATTGAGGAAGCAGAGGGGAAAGGAGCCCTTCAT GTCACTGGTCAACTTGGAGATGTTATGAAAGAAAGTGCCCAAATTGCTCACACTGTTGCC AGAGCGATATTGCTCGATAAAGATCCAGATAACCACACTTTCTTTTCCAATTCCAAGCTT CATCTCCACGTTCCTGCAGGGGCCACGCCGAAGGATGGGCCTAGTGCTGGTTGCACCATG ATCACATCCATGTTGTCCGTTGCCATGAAGAAGCCTATCAAGAGGGATTTAGCAATGACA GGGGAAGTAACATTAACTGGGAGGATCCTTCCAATTGGTGGGGTTAAGGAGAAAACGATA GCTGCAAGGAGGAGCGATGTGAAGACCATCATATTCCCTTTAGCTAACAAAAGGGATTTC GATGAGCTTGCCCCTAATGTAAAAGAAGGTCTTGACGTTCATTTTGTAGATGACTACAAT CAGATATTTGATTTGGCTTTCAGTGATGGTCAAAATGAGAAAAAATGA
PEP MLKLLSSSSSSSLHGRLHSLRPGPTELASPVLRVLGSLTGLTWPSPNSARRAFFCSDGSD GSDQVVEIEFKGAGAEAEAEAESKSSSAIVSTNPRPEDYLTVLALPLPHRPLFPGFYMPI YVKDPKLLAALQESRKRQAPYAGAFLLKDEPGTDPSLVSGSETDKNIHDLKGKELFNRLH EVGTLAQISSIQGDQVVLIGHRRLRITEMDKPYNKDDDVIKATSFEVISTLRDVLKTSSL WRDHVQTYTQHIGDFNFPRLADFGAAISGANKLQCQKVLEELDVYKRLKLTLELVKKEIE ISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTALSEKFRERLEPNREN CPPHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTSIPWGNYSDENFDVLRAQKILDE DHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRNFFRFSV GGLSDVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLE LLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVEMIPNPLLDRMEVISIAGYITDEKMHI ARDYLEKTTREACGIKPEQVEVTDAALLALIENYCREAGVRNLQKHIEKIYRKIALQLVR QGASDEAAVADQIQSLPGRPAAVEVQLVDTDEAQVEDVDKLDQNVVSSKNQTAAESLDGN DHDHSSETSAEEVTIQMDLPDEPAVVEVQVADTDEPVDSKDAKETAKIQEGGATKTVEKV LVDSSNLADFVGKPVFHAERIYDQTPIGVVMGLAWTAMGGSTLYIETTQIEEAEGKGALH VTGQLGDVMKESAQIAHTVARAILLDKDPDNHTFFSNSKLHLHVPAGATPKDGPSAGCTM ITSMLSVAMKKPIKRDLAMTGEVTLTGRILPIGGVKEKTIAARRSDVKTIIFPLANKRDF DELAPNVKEGLDVHFVDDYNQIFDLAFSDGQNEKK


| Top |