Cherry SNP DataBase

Gene information

Gene Pav_sc0000793.1_g210.1.mk
Chromosome name PAV_r1.0chr2
start 2167740
end 2170026
PAV_r1.0 name Pav_sc0000793.1
start 144317
end 146603
direction +
Annotation NR PREDICTED: probable inactive serine/threonine-protein kinase slob2
Sequence CDS ATGGACAACGAAACTAACCAAGAAAACCCATCTCTCCTCCCAAACAATTACACCTCCACA ACCAAGGAATTAGAGTCTCCAAGATCAAAACCCCAACAACCTCTTGGTGTTGGCGGCAGC AGTGACAGGCTAAAAAGAGATGAGTGGAGTGAAGGAGCAGTTTCTAGTCTCCTTGAGGCC TATGAGACCAAATGGGTTCTCAGAAACAGAGCAAAACTCAAAGGCCATGATTGGGAAGAT GTTGCAAGACATGTCTCGTCGCGTGCCAATTGTACCAAGTCCCCCAAGACTCAAACCCAG TGCAAGAACAAGATTGAGTCCATGAAGAAACGGTACCGTTCTGAGTCTGCCACTGCTGAT GGTTCATCATGGCCTCTCTATCCAAGGCTTGATCTTCTGCTACGTGGCAGTGGGCCATCC CCAACAGCAGCATCAGCAGCAGCAACTGTAGCAGCTGCAGCTATACCACCACCACCACCA CCACCACCACTGCCACTACAACTGCCTCCTCCGCCGCCTCAGAACAATCATCCTTTGATG CTACTGGAGACATCAGCGTCGCTGCCACCACAGCCACCACCTACTGCTCCTCCTCAACCT CTAGGAACTGCCCAAAATTCATATGGATCCAATGGTGTTGATCATAGGGTGGCCAAGGAA GATGGAATGGGTATGAAATTGTCAGACCATGCATCAGACAAGAACCCTTTGGAGATAGAC AGTAGCACCCCAGCTCTTTACAGTGACAAGGAAAAATTAAGGTCCAAGAGAATGAAGAGG AAGATAGAGAAAAAGAAGCGGCGAAGACGGGAGGAAGTAGAGATAGCAGAGAGCATAAGA TGGTTAGCAGAGGTTGTGGTGAGATCAGAGCAGGCAAGAATGGACACAATGAGAGAGATC GAGAGGATGAGAGTTGAGGCAGAGGCTAAGAGAGGAGAAATGGATCTCAAGCGCACAGAA ATTATTGCCAATACACAGTTGGAGATTGCAAGGCTCTTTGCAGCTGGTGTTGGCAAAGGG GTTGATTCTTCTTTAAGAATTGGAAGAAGTTGA
PEP MDNETNQENPSLLPNNYTSTTKELESPRSKPQQPLGVGGSSDRLKRDEWSEGAVSSLLEA YETKWVLRNRAKLKGHDWEDVARHVSSRANCTKSPKTQTQCKNKIESMKKRYRSESATAD GSSWPLYPRLDLLLRGSGPSPTAASAAATVAAAAIPPPPPPPPLPLQLPPPPPQNNHPLM LLETSASLPPQPPPTAPPQPLGTAQNSYGSNGVDHRVAKEDGMGMKLSDHASDKNPLEID SSTPALYSDKEKLRSKRMKRKIEKKKRRRREEVEIAESIRWLAEVVVRSEQARMDTMREI ERMRVEAEAKRGEMDLKRTEIIANTQLEIARLFAAGVGKGVDSSLRIGRS


| Top |