Cherry SNP DataBase

Gene information

Gene Pav_sc0000800.1_g1060.1.mk
Chromosome name PAV_r1.0chr1
start 33182980
end 33193605
PAV_r1.0 name Pav_sc0000800.1
start 618316
end 628941
direction +
Annotation NR PREDICTED: protein tesmin/TSO1-like CXC 5
Sequence CDS ATGGAGCAGAGCGAAACGGTCTCCCAAATCGCACCGAAGAAATTGGCGAGGCAATTAGAT TTCACGACGGTGTGTCGAGCGTCGGCGAACGCGGCGTTGCCGGAGGTGCAGCTACAGCTA CAGCTACAGTCACCGTCACAGGCGCAGCTGTCACAAAACTCACCGGCAAAATCGCACGTG CATTTGCAGTTACAGTCGCCACTGCCGCCGCCGGTACCGCAGTCACCGAAACAGCTAACA CCGCCACCAGCGATTCCACAGTTTCCGGCTAGGCCGAGTCCCGCGCCGGCGGCGAACGCT CGGATTCAGCACCCGGGGCACAAGCTTTCGATCTCGACATTGCAAAGTGCAATTATTTTT CACGATTTTGAGCATTTATTAATGGAGCAGAGCGAAACGGTCTCCCAAATCGCACCGAAG AAATTGGCGAGGCAATTAGATTTCACGACGGTGTGTCGAGCGTCGGCGAACGCGGCGTTG CCGGAGGTGCAGCTACAGCTACAGCTACAGTCACCGTCACAGGCGCAGCTGTCACAAAAC TCACCGGCAAAATCGCACGTGCATTTGCAGTTACAGTCGCCACTGCCGCCGCCGGTACCG CAGTCACCGAAACAGCTAACACCGCCACCAGCGATTCCACAGTTTCCGGCTAGGCCGAGT CCCGCGCCGGCGGCGAACGCTCGGATTCAGCACCCGGTGCACAAGCTTTCGATCTCGACA TTGCAAACGAGTAAACAAGAGTCTCCTATATCACGGCAACGTGGCGATGGAAAAGACGCC ACTCCTAAGAAGCAGAAGCAATGTAATTGTAAAAACTCTCGGTGCCTGAAGTTGTACTGT GAGTGCTTTGCAGCTGGAATTTATTGTGAAGGCTGCAACTGCTCGAATTGTCACAATAAT GTGGACAATGAAGCTGCTAGGCAGGAGGCAGTTGGATTAATTTTAGAACGTAATCCAAAT GCTTTCAGACCAAAGATTGCTAGCAGCCCACAAGAATCTCGTGATGGTAGGGAAGATGCT GGTGAAATTCAAGCACCTGGAAAGCACAATAAAGGATGTCATTGCAGGAAATCAGGGTGC CTCAAGAAATATTGTGAGTGCTTCCAGGCCAATATTCTATGCTCTGAAAATTGTAAATGC ATGGGCTGCAAGAACTTTGAAGGAAGTGAAGAAAGAAGAGCTCTCCATCATGAAGACCAC AATACCGTGGCCTACATGCAGCAGGCTAATGCAGCCATCAGTGGGGCCATTGGATCCTCT GGTTATGGGACCCCTCTGGTGTCCAGAAAAAGAAAGAGCTACGAACTCTATTTTGGTGCT ACAAATCAAACAACTCATCCAATTAAACAACCTCAACAGGAAAATCATCTAAGACCTCCT ATGGCCTCGTCTTCTCTGTCATCTGTTCCAACTTGTCGCACTGCTAATGCAGCAGTATCA AGATCTTCAAAATCCACATACAGATCTCCATTGGCGGATATTATCCAATCAAAGAACATA AAGGATTTGTGCTCACGTCTGGTTGTAGTTTCAGGAGCAGCTGCAGAGGCACTTGCAGGA AATAGGCACAGAGAGACAATTGATAAGTCCAGTACCAATTTATCCACTCAAGAGGGGAAA GAAGGTAAAAAGGAACATGATATTCAAAATTCTGTGCATGATGACCATTTAGGAGTGAAC GAAGCAGATAGAGATGAGAGCAACTATTCTGGATTAAATGGAGGTGATGTGCAAAATAGC AGGCCAATGTCCCCTGGAACACTTGCCCTGATGTGTGATGAACAAGATAAGATGTTTATG GCAGCTGGATTGCCAAATGGTGTGGGAAGTAGTAGTCCAAGCATGACTCAGAAGTCAACT CAGGAAATAGGATGCACAGAGGTTTATGCGGAACAGGAAAGGCTTGTACTGACCGGGTTC AGGGATTTCCTTAACCATCTTATTACTCGAGGGAGCATAAAAGAAACAATGTGTTCTCCC CAAGCCAAAAGAGAGAGGGTAAGCCAAAAAGAACCTGTGCAGGGTGGAACTGCAAAACCT AGCCCCGAACCCAGGTGCCAGAAAGAGGCATACAGCAACGGCGTTGCAAAATCTCCTGTT TCAGCAAACGGTAAAATGCTTCAGCCAGTAACGATGCTTCATCCGGTAGCAACGGTCACT TCTGGTGACAATGATCTGTCTCTAAAGGTGGTAAAGAAAAAGCACAACCCACCCTGTGCC AATATAATCAAACCATCGCCATCCAAAAAGGCCCTCATAATTTGTATTTATTACTTTATC GTGCCATTGTGTGGAAAACGCATCATCATCATGCATCGCTCTCTCCTTAATGCTCATCAA CCACCTATGAGCTTCACCCTCACATCCCGCAACTCCAATTCGCCAAGAACCGTACTCTCA CACGTGGCACATACTATGGCGCACACTTGTCCACGATCGCTACCTACCTCTGCGCCAAAA CTGTCCTATAAATACCGGTCATCGTCCCAGACCAGAAGCGTATCCGATTCCACTGAGACT GCAATGAGCCCAGCAATGGAGGAAGCTCTCGACGACGTCCAGAAGCTTCGGGATGAGTTC CTGAAAGTCCTGCGTAGCAGACGATCGGGCGAAGTTCCGTTATCGGTTGAACCGGCAAAA CCAGTGGCTCATCCATTGTTTCAGGAGGCTTCTCCGCCAACTTTCAGTGAGGCAATGAAC GCTTGTCCCAAGGCCAACATCCCCAATTTTAAGGATAAGCTACATGAGGAAAACCTTTAC TTAATTACTGAGGAAGGAGAGCAAGGGCGGTTACCCGTGTGGATTTTAAGCATGAAGGAA AACAATACCCAGAAAAGGCCTGCTGTTGTTTTTCTGCATAGTACAAACAAAAACAAAGAG TGGTTAAGACCATTGCTTGAGGCATATGCTTCAAGGGGATATGTAGCAATTGCCATTGAT TCTCGCTACCATGGTGAACGTGCCAGCAATATATCCACTTACCGAGATGCTCTCATATCA TCGTGGGAAAAGGGTGATACAATGCCATTCTTATTTGATACGACCTGGGACTTGATAAAA TTGGCAGATTATCTAACAACACAGAGGGAGGATGTAGACCATAGTAGGATAGGAATCACT GGTGAATCACTTGGAGGTATGCATGCATGGTTTGCTGCTGCTGCTGATACCCGCTATGCA GTAGTGGTCCCTATTATTGGTGTTCAGGGGTTTAGATGGGCCATAGACAATGATAAGTGG CAGGCTCGAGTTGACAGTATAAAACCTGTCTTTGAGGCAGCACAAATTGATCTCGGGAAG ACTTCGATTGACAAAGAAGTTGTGGAGAAGGTCTGGGATAGGATTGCTCCTGGTCTAGCC TCCAAGTTTGATTCTCCTTACACAATTCCTGCTATTGCACCACGCCCTCTGTTGATTGTG AATGGTGCGGAAGATCCTCGATGTCCACTTGCTGGTCTGGAAATCCCCAAGTCAAGAGCA TGCAAGGCTTATGAAGATGCGCAGAGTATGCATAACTTTAAGTTGATAGCAGAGCCAGGC ATCGGCCACCAAATGACTGCGTTTATGGTAAAAGAAGCCAGCTACTGGTTAGACCAATTT CTCATGCCGTGA
PEP MEQSETVSQIAPKKLARQLDFTTVCRASANAALPEVQLQLQLQSPSQAQLSQNSPAKSHV HLQLQSPLPPPVPQSPKQLTPPPAIPQFPARPSPAPAANARIQHPGHKLSISTLQSAIIF HDFEHLLMEQSETVSQIAPKKLARQLDFTTVCRASANAALPEVQLQLQLQSPSQAQLSQN SPAKSHVHLQLQSPLPPPVPQSPKQLTPPPAIPQFPARPSPAPAANARIQHPVHKLSIST LQTSKQESPISRQRGDGKDATPKKQKQCNCKNSRCLKLYCECFAAGIYCEGCNCSNCHNN VDNEAARQEAVGLILERNPNAFRPKIASSPQESRDGREDAGEIQAPGKHNKGCHCRKSGC LKKYCECFQANILCSENCKCMGCKNFEGSEERRALHHEDHNTVAYMQQANAAISGAIGSS GYGTPLVSRKRKSYELYFGATNQTTHPIKQPQQENHLRPPMASSSLSSVPTCRTANAAVS RSSKSTYRSPLADIIQSKNIKDLCSRLVVVSGAAAEALAGNRHRETIDKSSTNLSTQEGK EGKKEHDIQNSVHDDHLGVNEADRDESNYSGLNGGDVQNSRPMSPGTLALMCDEQDKMFM AAGLPNGVGSSSPSMTQKSTQEIGCTEVYAEQERLVLTGFRDFLNHLITRGSIKETMCSP QAKRERVSQKEPVQGGTAKPSPEPRCQKEAYSNGVAKSPVSANGKMLQPVTMLHPVATVT SGDNDLSLKVVKKKHNPPCANIIKPSPSKKALIICIYYFIVPLCGKRIIIMHRSLLNAHQ PPMSFTLTSRNSNSPRTVLSHVAHTMAHTCPRSLPTSAPKLSYKYRSSSQTRSVSDSTET AMSPAMEEALDDVQKLRDEFLKVLRSRRSGEVPLSVEPAKPVAHPLFQEASPPTFSEAMN ACPKANIPNFKDKLHEENLYLITEEGEQGRLPVWILSMKENNTQKRPAVVFLHSTNKNKE WLRPLLEAYASRGYVAIAIDSRYHGERASNISTYRDALISSWEKGDTMPFLFDTTWDLIK LADYLTTQREDVDHSRIGITGESLGGMHAWFAAAADTRYAVVVPIIGVQGFRWAIDNDKW QARVDSIKPVFEAAQIDLGKTSIDKEVVEKVWDRIAPGLASKFDSPYTIPAIAPRPLLIV NGAEDPRCPLAGLEIPKSRACKAYEDAQSMHNFKLIAEPGIGHQMTAFMVKEASYWLDQF LMP


| Top |